| VFD746 | |
| Library | VF (Link to library) | 
| Clone ID | VFD746 (Link to dictyBase) | 
| Atlas ID | - | 
| NBRP ID | - | 
| dictyBase ID | - | 
| Link to Contig | Contig-U15827-1 | 
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFD7-B/VFD746Q.Seq.d/ | 
| Representative seq. ID | VFD746P (Link to Original site) | 
| Representative DNA sequence |  >VFD746 (VFD746Q) /CSM/VF/VFD7-B/VFD746Q.Seq.d/ | 
| sequence update | 2001. 6. 1 | 
| Translated Amino Acid sequence |  KSSEKSTQEVEQVIKPEKTPILDTSKWPLLLKNYDQLSVRTGHYTPIPNGHSPLKRPIKE | 
| Translated Amino Acid sequence (All Frames) |  Frame A: | 
| Homology vs CSM-cDNA |  
 | 
| own update | 2004.12.25 | 
| Homology vs DNA |  
 | 
| dna update | 2003. 9.15 | 
| Homology vs Protein |  
 | 
| protein update | 2009. 6.18 | 
| PSORT |  
 | 
| 5' end seq. ID | VFD746F | 
| 5' end seq. |  >VFD746F.Seq | 
| Length of 5' end seq. | 586 | 
| 3' end seq. ID | VFD746Z | 
| 3' end seq. |  >VFD746Z.Seq | 
| Length of 3' end seq. | 690 | 
| Connected seq. ID | VFD746P | 
| Connected seq. |  >VFD746P.Seq | 
| Length of connected seq. | 1276 | 
| Full length Seq ID | - | 
| Full length Seq. | - | 
| Length of full length seq. | - |