| VFI871 | |
| Library | VF (Link to library) |
| Clone ID | VFI871 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U08780-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFI8-C/VFI871Q.Seq.d/ |
| Representative seq. ID | VFI871P (Link to Original site) |
| Representative DNA sequence | ![]() >VFI871 (VFI871Q) /CSM/VF/VFI8-C/VFI871Q.Seq.d/ |
| sequence update | 2001.11.22 |
| Translated Amino Acid sequence | ![]() nfihff*kdnyyyfs*NNRKMIEEHNCFEEFINTAAIGEQQVYGEYKSKLDSFTDESKLP |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.25 |
| Homology vs DNA | ![]()
|
| dna update | 2009. 1.11 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 6.21 |
| PSORT | ![]()
|
| 5' end seq. ID | VFI871F |
| 5' end seq. | ![]() >VFI871F.Seq |
| Length of 5' end seq. | 507 |
| 3' end seq. ID | VFI871Z |
| 3' end seq. | ![]() >VFI871Z.Seq |
| Length of 3' end seq. | 755 |
| Connected seq. ID | VFI871P |
| Connected seq. | ![]() >VFI871P.Seq |
| Length of connected seq. | 1242 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |