VFK242 | |
Library | VF (Link to library) |
Clone ID | VFK242 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16260-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK242Q.Seq.d/ |
Representative seq. ID | VFK242P (Link to Original site) |
Representative DNA sequence | >VFK242 (VFK242Q) /CSM/VF/VFK2-B/VFK242Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2009. 2. 4 |
Homology vs Protein |
|
protein update | 2009. 6.22 |
PSORT |
|
5' end seq. ID | VFK242F |
5' end seq. | >VFK242F.Seq |
Length of 5' end seq. | 606 |
3' end seq. ID | VFK242Z |
3' end seq. | >VFK242Z.Seq |
Length of 3' end seq. | 292 |
Connected seq. ID | VFK242P |
Connected seq. | >VFK242P.Seq |
Length of connected seq. | 878 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |