VHB375 | |
Library | VH (Link to library) |
Clone ID | VHB375 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11004-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB375Q.Seq.d/ |
Representative seq. ID | VHB375P (Link to Original site) |
Representative DNA sequence | ![]() >VHB375 (VHB375Q) /CSM/VH/VHB3-D/VHB375Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | ![]() PIXSENSATGHTSPPNNSATXTTSSTSAQPITVLPTEIIKTFEHLLRKSQRXFIGLXDLP |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.24 |
Homology vs DNA | ![]()
|
dna update | 2007. 4. 3 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.27 |
PSORT | ![]()
|
5' end seq. ID | VHB375F |
5' end seq. | ![]() >VHB375F.Seq |
Length of 5' end seq. | 419 |
3' end seq. ID | VHB375Z |
3' end seq. | ![]() >VHB375Z.Seq |
Length of 3' end seq. | 692 |
Connected seq. ID | VHB375P |
Connected seq. | ![]() >VHB375P.Seq |
Length of connected seq. | 1091 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |