| VHB375 | |
| Library | VH (Link to library) |
| Clone ID | VHB375 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U11004-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB375Q.Seq.d/ |
| Representative seq. ID | VHB375P (Link to Original site) |
| Representative DNA sequence | ![]() >VHB375 (VHB375Q) /CSM/VH/VHB3-D/VHB375Q.Seq.d/ |
| sequence update | 2002.10.25 |
| Translated Amino Acid sequence | ![]() PIXSENSATGHTSPPNNSATXTTSSTSAQPITVLPTEIIKTFEHLLRKSQRXFIGLXDLP |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.24 |
| Homology vs DNA | ![]()
|
| dna update | 2007. 4. 3 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 6.27 |
| PSORT | ![]()
|
| 5' end seq. ID | VHB375F |
| 5' end seq. | ![]() >VHB375F.Seq |
| Length of 5' end seq. | 419 |
| 3' end seq. ID | VHB375Z |
| 3' end seq. | ![]() >VHB375Z.Seq |
| Length of 3' end seq. | 692 |
| Connected seq. ID | VHB375P |
| Connected seq. | ![]() >VHB375P.Seq |
| Length of connected seq. | 1091 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |