| VHB375 | |
| Library | VH (Link to library) | 
| Clone ID | VHB375 (Link to dictyBase) | 
| Atlas ID | - | 
| NBRP ID | - | 
| dictyBase ID | - | 
| Link to Contig | Contig-U11004-1 | 
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB375Q.Seq.d/ | 
| Representative seq. ID | VHB375P (Link to Original site) | 
| Representative DNA sequence |  >VHB375 (VHB375Q) /CSM/VH/VHB3-D/VHB375Q.Seq.d/ | 
| sequence update | 2002.10.25 | 
| Translated Amino Acid sequence |  PIXSENSATGHTSPPNNSATXTTSSTSAQPITVLPTEIIKTFEHLLRKSQRXFIGLXDLP | 
| Translated Amino Acid sequence (All Frames) |  Frame A: | 
| Homology vs CSM-cDNA |  
 | 
| own update | 2004.12.24 | 
| Homology vs DNA |  
 | 
| dna update | 2007. 4. 3 | 
| Homology vs Protein |  
 | 
| protein update | 2009. 6.27 | 
| PSORT |  
 | 
| 5' end seq. ID | VHB375F | 
| 5' end seq. |  >VHB375F.Seq | 
| Length of 5' end seq. | 419 | 
| 3' end seq. ID | VHB375Z | 
| 3' end seq. |  >VHB375Z.Seq | 
| Length of 3' end seq. | 692 | 
| Connected seq. ID | VHB375P | 
| Connected seq. |  >VHB375P.Seq | 
| Length of connected seq. | 1091 | 
| Full length Seq ID | - | 
| Full length Seq. | - | 
| Length of full length seq. | - |