VHK777 | |
Library | VH (Link to library) |
Clone ID | VHK777 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11159-1|Contig-U12695-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK7-D/VHK777Q.Seq.d/ |
Representative seq. ID | VHK777P (Link to Original site) |
Representative DNA sequence | ![]() >VHK777 (VHK777Q) /CSM/VH/VHK7-D/VHK777Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | ![]() yfil*ALKKMREFLKDDYDVIVCGGGPVGLATAYRCAKAGKKVLCLEKSVFFNGGGSSGD |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.24 |
Homology vs DNA | ![]()
|
dna update | 2008.11.24 |
Homology vs Protein | ![]()
|
protein update | 2009. 7.15 |
PSORT | ![]()
|
5' end seq. ID | VHK777F |
5' end seq. | ![]() >VHK777F.Seq |
Length of 5' end seq. | 554 |
3' end seq. ID | VHK777Z |
3' end seq. | ![]() >VHK777Z.Seq |
Length of 3' end seq. | 331 |
Connected seq. ID | VHK777P |
Connected seq. | ![]() >VHK777P.Seq |
Length of connected seq. | 865 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |