| VHN758 | |
| Library | VH (Link to library) | 
| Clone ID | VHN758 (Link to dictyBase) | 
| Atlas ID | - | 
| NBRP ID | - | 
| dictyBase ID | - | 
| Link to Contig | Contig-U11159-1|Contig-U12695-1 | 
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHN7-C/VHN758Q.Seq.d/ | 
| Representative seq. ID | VHN758P (Link to Original site) | 
| Representative DNA sequence |  >VHN758 (VHN758Q) /CSM/VH/VHN7-C/VHN758Q.Seq.d/ | 
| sequence update | 2002.10.25 | 
| Translated Amino Acid sequence |  *ALKKMREFLKDDYDVIVCGGGPVGLATAYRCAKAGKKVLCLEKSVFFNGGGSSGDVVRM | 
| Translated Amino Acid sequence (All Frames) |  Frame A: | 
| Homology vs CSM-cDNA |  
 | 
| own update | 2004.12.25 | 
| Homology vs DNA |  
 | 
| dna update | 2008.12. 8 | 
| Homology vs Protein |  
 | 
| protein update | 2009. 5.17 | 
| PSORT |  
 | 
| 5' end seq. ID | VHN758F | 
| 5' end seq. |  >VHN758F.Seq | 
| Length of 5' end seq. | 561 | 
| 3' end seq. ID | VHN758Z | 
| 3' end seq. |  >VHN758Z.Seq | 
| Length of 3' end seq. | 298 | 
| Connected seq. ID | VHN758P | 
| Connected seq. |  >VHN758P.Seq | 
| Length of connected seq. | 839 | 
| Full length Seq ID | - | 
| Full length Seq. | - | 
| Length of full length seq. | - |