| VHO717 | |
| Library | VH (Link to library) |
| Clone ID | VHO717 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U11159-1|Contig-U12695-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHO7-A/VHO717Q.Seq.d/ |
| Representative seq. ID | VHO717P (Link to Original site) |
| Representative DNA sequence | ![]() >VHO717 (VHO717Q) /CSM/VH/VHO7-A/VHO717Q.Seq.d/ |
| sequence update | 2002.10.25 |
| Translated Amino Acid sequence | ![]() yfil*ALKKMREFLKDDYDVIVCGGGPVGLATAYRCAKAGKKVLCLEKSVFFNGGGSSGD |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.25 |
| Homology vs DNA | ![]()
|
| dna update | 2008.12.12 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 7.19 |
| PSORT | ![]()
|
| 5' end seq. ID | VHO717F |
| 5' end seq. | ![]() >VHO717F.Seq |
| Length of 5' end seq. | 575 |
| 3' end seq. ID | VHO717Z |
| 3' end seq. | ![]() >VHO717Z.Seq |
| Length of 3' end seq. | 292 |
| Connected seq. ID | VHO717P |
| Connected seq. | ![]() >VHO717P.Seq |
| Length of connected seq. | 847 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |