VHP888 | |
Library | VH (Link to library) |
Clone ID | VHP888 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11159-1|Contig-U12695-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP8-D/VHP888Q.Seq.d/ |
Representative seq. ID | VHP888P (Link to Original site) |
Representative DNA sequence | ![]() >VHP888 (VHP888Q) /CSM/VH/VHP8-D/VHP888Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | ![]() inf*nlnkn*c*iffksff***KMREFLKDDYDVIVCGGGPVGLATAYRCAKAGKKVLCL |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.25 |
Homology vs DNA | ![]()
|
dna update | 2008.12.23 |
Homology vs Protein | ![]()
|
protein update | 2009. 7.21 |
PSORT | ![]()
|
5' end seq. ID | VHP888F |
5' end seq. | ![]() >VHP888F.Seq |
Length of 5' end seq. | 618 |
3' end seq. ID | VHP888Z |
3' end seq. | ![]() >VHP888Z.Seq |
Length of 3' end seq. | 466 |
Connected seq. ID | VHP888P |
Connected seq. | ![]() >VHP888P.Seq |
Length of connected seq. | 1064 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |