VSI182 | |
Library | VS (Link to library) |
Clone ID | VSI182 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G21487 |
dictyBase ID | DDB0190404 |
Link to Contig | Contig-U02965-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI1-D/VSI182Q.Seq.d/ |
Representative seq. ID | VSI182P (Link to Original site) |
Representative DNA sequence | >VSI182 (VSI182Q) /CSM/VS/VSI1-D/VSI182Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | fkhkytmnklllaflffgliasvtismkidvrtqsepnlgdiplclicdfavgkiekyld |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2009. 7. 4 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI182F |
5' end seq. | >VSI182F.Seq |
Length of 5' end seq. | 439 |
3' end seq. ID | VSI182Z |
3' end seq. | >VSI182Z.Seq |
Length of 3' end seq. | 410 |
Connected seq. ID | VSI182P |
Connected seq. | >VSI182P.Seq |
Length of connected seq. | 849 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |