VSJ223 | |
Library | VS (Link to library) |
Clone ID | VSJ223 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14033-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ2-A/VSJ223Q.Seq.d/ |
Representative seq. ID | VSJ223P (Link to Original site) |
Representative DNA sequence | ![]() >VSJ223 (VSJ223Q) /CSM/VS/VSJ2-A/VSJ223Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | ![]() sgesafplgglvtvpntrdaadtlrqyftqlrlelgvrlcqrvyavdpskankwwicfsk |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.25 |
Homology vs DNA | ![]()
|
dna update | 2003. 7.18 |
Homology vs Protein | ![]()
|
protein update | 2009. 3.25 |
PSORT | ![]()
|
5' end seq. ID | VSJ223F |
5' end seq. | ![]() >VSJ223F.Seq |
Length of 5' end seq. | 290 |
3' end seq. ID | VSJ223Z |
3' end seq. | ![]() >VSJ223Z.Seq |
Length of 3' end seq. | 237 |
Connected seq. ID | VSJ223P |
Connected seq. | ![]() >VSJ223P.Seq |
Length of connected seq. | 527 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |