VSJ669 | |
Library | VS (Link to library) |
Clone ID | VSJ669 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15177-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ6-C/VSJ669Q.Seq.d/ |
Representative seq. ID | VSJ669E (Link to Original site) |
Representative DNA sequence | >VSJ669 (VSJ669Q) /CSM/VS/VSJ6-C/VSJ669Q.Seq.d/ |
sequence update | 2001. 3.26 |
Translated Amino Acid sequence | llk*IIYIYILLLINMEKEQVWYITGCTSGCGLALVEKLLKIKGTKVAGTTRDLKKIEQL |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2003. 7.21 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ669F |
5' end seq. | >VSJ669F.Seq |
Length of 5' end seq. | 528 |
3' end seq. ID | VSJ669Z |
3' end seq. | >VSJ669Z.Seq |
Length of 3' end seq. | 639 |
Connected seq. ID | VSJ669P |
Connected seq. | >VSJ669P.Seq |
Length of connected seq. | 1167 |
Full length Seq ID | VSJ669E |
Full length Seq. | >VSJ669E.Seq |
Length of full length seq. | 946 |