| VSJ669 | |
| Library | VS (Link to library) |
| Clone ID | VSJ669 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U15177-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ6-C/VSJ669Q.Seq.d/ |
| Representative seq. ID | VSJ669E (Link to Original site) |
| Representative DNA sequence | ![]() >VSJ669 (VSJ669Q) /CSM/VS/VSJ6-C/VSJ669Q.Seq.d/ |
| sequence update | 2001. 3.26 |
| Translated Amino Acid sequence | ![]() llk*IIYIYILLLINMEKEQVWYITGCTSGCGLALVEKLLKIKGTKVAGTTRDLKKIEQL |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2003. 1.10 |
| Homology vs DNA | ![]()
|
| dna update | 2003. 7.21 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 3.25 |
| PSORT | ![]()
|
| 5' end seq. ID | VSJ669F |
| 5' end seq. | ![]() >VSJ669F.Seq |
| Length of 5' end seq. | 528 |
| 3' end seq. ID | VSJ669Z |
| 3' end seq. | ![]() >VSJ669Z.Seq |
| Length of 3' end seq. | 639 |
| Connected seq. ID | VSJ669P |
| Connected seq. | ![]() >VSJ669P.Seq |
| Length of connected seq. | 1167 |
| Full length Seq ID | VSJ669E |
| Full length Seq. | ![]() >VSJ669E.Seq |
| Length of full length seq. | 946 |