Contig-U04201-1 |
Contig ID |
Contig-U04201-1 |
Contig update |
2002. 9.13 |
Contig sequence |
 |
Gap |
no gap |
Contig length |
903 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
7196341 |
End point |
7195438 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
4 |
Number of EST |
4 |
Link to clone list |
U04201 |
List of clone(s) |
 |
Translated Amino Acid sequence |
 |
Translated Amino Acid sequence (All Frames) |
 |
own update |
2004. 6. 9 |
Homology vs CSM-cDNA |
 |
dna update |
2009. 6.14 |
Homology vs DNA |
 Query= Contig-U04201-1 (Contig-U04201-1Q) /CSM_Contig/Contig-U04201-1Q.Seq.d (903 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AC115584) Dictyostelium discoideum chromosome 2 map complem... 1312 0.0 1 (C89713) Dictyostelium discoideum slug cDNA, clone SSG229. 1239 0.0 1 (AF310892) Dictyostelium discoideum citrate synthase (gltA) ... 1237 0.0 1 (C92167) Dictyostelium discoideum slug cDNA, clone SSD179. 983 0.0 1 (C91905) Dictyostelium discoideum slug cDNA, clone SSC167. 771 0.0 1 (AU062131) Dictyostelium discoideum slug cDNA, clone SLH712. 769 0.0 1 (AU073134) Dictyostelium discoideum slug cDNA, clone SSG229. 470 e-128 1 (AU039399) Dictyostelium discoideum slug cDNA, clone SLH712. 295 2e-75 1 (BJ344693) Dictyostelium discoideum cDNA clone:dda20n05, 3' ... 76 5e-34 4 (BJ347083) Dictyostelium discoideum cDNA clone:dda26f02, 3' ... 76 6e-34 4 (BJ344545) Dictyostelium discoideum cDNA clone:dda19n18, 3' ... 76 7e-34 4 (BJ344480) Dictyostelium discoideum cDNA clone:dda19p10, 3' ... 58 7e-33 5 (BJ345534) Dictyostelium discoideum cDNA clone:dda28b05, 3' ... 76 9e-27 3 (C94200) Dictyostelium discoideum slug cDNA, clone SSK530. 76 1e-26 3 (C84787) Dictyostelium discoideum slug cDNA, clone SSF821. 76 1e-26 3 (BJ344176) Dictyostelium discoideum cDNA clone:dda18m14, 3' ... 76 1e-26 3 (BJ399667) Dictyostelium discoideum cDNA clone:dds6m24, 3' e... 76 3e-26 3 (BJ341496) Dictyostelium discoideum cDNA clone:dda6m19, 3' e... 76 3e-26 3 (BJ400352) Dictyostelium discoideum cDNA clone:dds9j23, 3' e... 76 3e-26 3 (AY124377) Dictyostelium discoideum citrate synthase (cshA) ... 76 5e-26 3 (BJ345118) Dictyostelium discoideum cDNA clone:dda21m17, 3' ... 68 2e-24 3 (AB109907) Tetrahymena thermophila tgCS mRNA for putative ci... 86 1e-22 2 (EV834772) TT1D349TH Tetrahymena thermophila SB210 cDNA libr... 86 1e-22 2 (EV834773) TT1D349TV Tetrahymena thermophila SB210 cDNA libr... 86 1e-22 2 (EV832272) FTSCA64TF Tetrahymena thermophila SB210 cDNA libr... 86 1e-22 2 (BJ381843) Dictyostelium discoideum cDNA clone:ddc42i19, 3' ... 76 7e-21 2 (AU052390) Dictyostelium discoideum slug cDNA, clone SLD239. 76 7e-21 2 (BJ340164) Dictyostelium discoideum cDNA clone:dda11m19, 3' ... 76 3e-20 2 (C93947) Dictyostelium discoideum slug cDNA, clone SSL893. 76 1e-18 2 (C94049) Dictyostelium discoideum slug cDNA, clone SSG330. 76 1e-17 3 (CT764936) Paramecium tetraurelia 5-PRIME EST from clone LK0... 72 2e-17 3 (CT793420) Paramecium tetraurelia 5-PRIME EST from clone LK0... 72 3e-17 3 (FE261619) CAZO2120.rev CAZO Naegleria gruberi Flagellate St... 50 1e-15 4 (FE245555) CAPG8941.rev CAPG Naegleria gruberi amoeba stage ... 50 3e-15 4 (FE236049) CAPG3685.rev CAPG Naegleria gruberi amoeba stage ... 50 3e-15 4 (CT775760) Paramecium tetraurelia 5-PRIME EST from clone LK0... 72 2e-14 2 (CT816870) Paramecium tetraurelia 5-PRIME EST from clone LK0... 72 2e-14 2 (CT752335) Paramecium tetraurelia 5-PRIME EST from clone LK0... 56 2e-13 3 (CT816558) Paramecium tetraurelia 5-PRIME EST from clone LK0... 56 2e-13 3 (EV165855) 0142665 Brassica napus Etiolated seedlings (Uni-Z... 48 3e-12 4 (FE239956) CAPG5619.rev CAPG Naegleria gruberi amoeba stage ... 58 2e-10 3 (ES998850) BNAEN3GH_UP_086_D04_15SEP2006_026 Brassica napus ... 48 5e-10 3 (FG559994) BN18DYSC_UP_081_A10_4MAR2008_080 BN18DYSC Brassic... 48 6e-10 3 (EV225083) 0107009 Brassica napus Damaged cotyledons Brassic... 48 6e-10 3 (ES909522) BNARO2GH_T3_006_F12_15DEC2006_086 Brassica napus ... 48 7e-10 3 (CX656017) PO02045A06 Poplar SC cDNA library Populus alba x ... 52 7e-09 3 (DT500139) PX0011.BR_F11 PT-X-FL-A-1 Populus trichocarpa cDN... 52 7e-09 3 (CN520950) GQ0106.B3_L16 GQ010 Populus trichocarpa x Populus... 58 8e-09 3 (DY008210) 19ACACYS_UP_023_E09_29OCT2004_071 Brassica napus ... 48 8e-09 3 (CT754885) Paramecium tetraurelia 3-PRIME EST from clone LK0... 54 9e-09 3 (CK119497) 212c13.p1 AtM1 Arabidopsis thaliana cDNA clone MP... 48 1e-08 3 (DT512296) WS02418.B21_O08 PTxD-ICC-N-A-14 Populus trichocar... 52 1e-08 3 (CT777665) Paramecium tetraurelia 5-PRIME EST from clone LK0... 54 1e-08 3 (FD958004) RS3H260TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 50 1e-08 2 (CT777868) Paramecium tetraurelia 5-PRIME EST from clone LK0... 54 1e-08 3 (DT489904) WS02543.B21_I02 PT-MB-N-A-15 Populus trichocarpa ... 52 1e-08 3 (AM828287) Nicotiana tabacum EST, clone nt006003066. 58 4e-08 2 (BT020195) Arabidopsis thaliana At3g58750 mRNA, complete cds. 48 4e-08 3 (BT015884) Arabidopsis thaliana At3g58750 gene, complete cds. 48 4e-08 3 (BX823473) Arabidopsis thaliana Full-length cDNA Complete se... 48 5e-08 3 (FG195554) AGN_PNL223br1_a2.trimmed.seq AGN_PNL Nicotiana ta... 58 5e-08 2 (FG175330) AGN_RNC122xc22r1.ab1 AGN_RNC Nicotiana tabacum cD... 58 6e-08 2 (FG167603) AGN_RNC007xd15r1.ab1 AGN_RNC Nicotiana tabacum cD... 58 6e-08 2 (FG158438) AGN_RNC024xj04r1.ab1 AGN_RNC Nicotiana tabacum cD... 58 6e-08 2 (EX067768) BR052412 pollen cDNA library KBPL Brassica rapa s... 48 8e-08 3 (EX122995) BR106825 mature green leaf cDNA library KHLM Bras... 48 9e-08 3 (EF616787) Bartonella sp. LAD 3335-2 clone s278_b20 GltA (gl... 44 1e-07 3 (CC886079) SALK_148183.36.85.x Arabidopsis thaliana TDNA ins... 48 1e-07 2 (CC885856) SALK_147925.54.55.x Arabidopsis thaliana TDNA ins... 48 1e-07 2 (EX137140) BR120970 root cDNA library KHRT Brassica rapa sub... 48 1e-07 3 (EX124319) BR108149 mature green leaf cDNA library KHLM Bras... 48 1e-07 3 (CD475400) nad03-20ms3-b04 Nad03 Nuphar advena cDNA clone na... 70 2e-07 1 (EV524738) RR1A441TF RR1(CS) Raphanus raphanistrum subsp. ma... 48 2e-07 2 (EX762791) RR3BW07TF RR3(NY) Raphanus raphanistrum subsp. ra... 48 2e-07 2 (EX766982) RR3BW07JQ RR3(NY) Raphanus raphanistrum subsp. ra... 48 2e-07 2 (EW739035) RS3AZ64JQ RS3(RT) Raphanus sativus cDNA 3', mRNA ... 48 2e-07 2 (EW733885) RS3AZ64TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 48 2e-07 2 (BU822514) UB38BPG02 Populus tremula cambium cDNA library Po... 58 4e-07 2 (EX032215) BR016859 callus cDNA library KBCG Brassica rapa s... 48 5e-07 2 (CX658574) PO01036F05 Poplar SC cDNA library Populus alba x ... 52 7e-07 2 (EH418276) OL3255F Brassica oleracea var. alboglabra leaf cD... 48 7e-07 2 (CV254803) WS02411.B21_D17 PTxD-ICC-N-A-14 Populus trichocar... 58 7e-07 2 (CV254796) WS02411.B21_D09 PTxD-ICC-N-A-14 Populus trichocar... 58 7e-07 2 (EX050440) BR035084 floral buds cDNA library KBFS Brassica r... 48 8e-07 2 (EV115463) 0120775 Brassica napus Root library Brassica napu... 48 8e-07 2 (CV263302) WS02020.B21_O15 PTxN-IB-N-A-11 Populus trichocarp... 58 8e-07 2 (EX117657) BR101487 cotyledon cDNA library KHCT Brassica rap... 48 9e-07 2 (DQ683195) Bartonella rochalimae isolate BMGH citrate syntha... 46 1e-06 2 (EE443931) 72ETGS24_UP_012_H09_20MAY2005_065 72ETGS24 Brassi... 48 2e-06 2 (EE457349) BNBS6DCT_UP_020_C04_13APR2005_028 Brassica napus ... 46 3e-06 2 (EE464257) BNSCS2CT_UP_025_E02_07JAN2005_008 Brassica napus ... 48 3e-06 2 (EH786372) CNSS25627.b1_E24.ab1 CNS(LMS) yellow starthistle ... 50 3e-06 2 (EC980493) WIN114.C21_P05 Muscat Hamburg pre-veraison berry ... 52 8e-06 3 (BG595902) EST494580 cSTS Solanum tuberosum cDNA clone cSTS1... 58 1e-05 2 (BI432696) EST535457 P. infestans-challenged potato leaf, co... 58 1e-05 2 (CK296300) EST759014 Nicotiana benthamiana mixed tissue cDNA... 50 1e-05 2 (BM408299) EST582626 potato roots Solanum tuberosum cDNA clo... 58 1e-05 2 (CK283600) EST746322 Nicotiana benthamiana mixed tissue cDNA... 50 1e-05 2 (BM404676) EST579003 potato roots Solanum tuberosum cDNA clo... 58 1e-05 2 (CK298871) EST761585 Nicotiana benthamiana mixed tissue cDNA... 50 1e-05 2 (BM408045) EST582372 potato roots Solanum tuberosum cDNA clo... 58 1e-05 2 (CK263753) EST709831 potato abiotic stress cDNA library Sola... 58 1e-05 2 (AC189221) Brassica rapa subsp. pekinensis clone KBrB010L05,... 48 1e-05 3 (EV231157) VV_PEa19b12.b1 Vitis vinifera cv. perlette LibA V... 52 1e-05 3 (EV229529) VV_PEa12h01.b1 Vitis vinifera cv. perlette LibA V... 52 1e-05 3 (EU770616) Bartonella clarridgeiae strain M9HN-SHQ citrate s... 44 2e-05 2 (EF616793) Bartonella sp. LAD 3335-2 clone s271_b20 GltA (gl... 42 2e-05 3 (EF616786) Bartonella sp. LAD 3335-2 clone s277_b20 GltA (gl... 42 2e-05 3 (EF616781) Bartonella sp. LAD 3335-2 clone s249_b20 GltA (gl... 42 2e-05 3 (EF616779) Bartonella sp. LAD 3335-2 clone s245_b20 GltA (gl... 42 2e-05 3 (EF616766) Bartonella sp. LAD 3335-1 clone s222_b19 GltA (gl... 42 2e-05 3 (EF616765) Bartonella sp. LAD 3334-3 clone s240_b18 GltA (gl... 42 2e-05 3 (EF616758) Bartonella sp. LAD 3334-3 clone s257_b18 GltA (gl... 42 2e-05 3 (EF616756) Bartonella sp. LAD 3334-3 clone s251_b18 GltA (gl... 42 2e-05 3 (EF616753) Bartonella sp. LAD 3334-3 clone s229_b18 GltA (gl... 42 2e-05 3 (EF616741) Bartonella sp. LAD 3333-4 clone s314_B15 GltA (gl... 42 2e-05 3 (EF616739) Bartonella sp. LAD 3333-4 clone s309_B15 GltA (gl... 42 2e-05 3 (EF616738) Bartonella sp. LAD 3333-4 clone s353_B15 GltA (gl... 42 2e-05 3 (EF616735) Bartonella sp. LAD 3333-4 clone s310_B15 GltA (gl... 42 2e-05 3 (EF616716) Bartonella sp. LAD 3332-2 clone s82_B11 GltA (glt... 42 2e-05 3 (EF616712) Bartonella sp. LAD 3332-2 clone s79_B11 GltA (glt... 42 2e-05 3 (EF616648) Bartonella sp. AEA10-17 clone s15_B1 GltA (gltA) ... 42 2e-05 3 (AY836149) Uncultured Bartonella sp. clone Cajamarca 1.P3 ci... 44 2e-05 2 (U84386) Bartonella clarridgeiae citrate synthase (gltA) gen... 44 2e-05 2 (EU551154) Bartonella sp. 1-1C citrate synthase gene, partia... 44 2e-05 2 (AY805110) Uncultured Bartonella sp. citrate synthase gene, ... 42 2e-05 3 (AY867869) Uncultured Bartonella sp. clone Cajamarca 2pb cit... 44 2e-05 2 (FL060876) 13094193 CERES-CL13 Zea mays cDNA clone 1387578 5... 54 2e-05 2 (EH724469) CNMM10891.b1_F11.ab1 CNM(LMS) spotted knapweed Ce... 42 2e-05 3 (AY124841) Arabidopsis thaliana At2g42790/F7D19.21 mRNA, com... 44 2e-05 3 (AX506858) Sequence 1553 from Patent WO0216655. 44 2e-05 3 (FL060877) 13079543 CERES-CL13 Zea mays cDNA clone 1372928 5... 54 3e-05 2 (BX819211) Arabidopsis thaliana Full-length cDNA Complete se... 44 3e-05 3 (AY048214) Arabidopsis thaliana At2g42790/F7D19.21 mRNA, com... 44 3e-05 3 (EX102862) BR089152 seed and seedling cDNA library KFSD Bras... 54 3e-05 2 (EV051365) BNSCS3CT_UP_183_E01_12MAY2007_007 Brassica napus ... 54 4e-05 2 (BH972248) odj23h03.g1 B.oleracea002 Brassica oleracea genom... 46 4e-05 2 (FD941859) RS1H604TF RS1(AR) Raphanus sativus var. oleiformi... 46 4e-05 2 (EV036147) BNSCS2CT_UP_280_A05_04MAY2007_047 Brassica napus ... 54 4e-05 2 (FD937402) RS1H604JQB RS1(AR) Raphanus sativus var. oleiform... 46 4e-05 2 (DV453330) CV02012B1H05.f1 CV02-normalized library Manihot e... 52 4e-05 2 (ES912135) BNARO2GH_T3_017_F04_15DEC2006_022 Brassica napus ... 54 5e-05 2 (EX119095) BR102925 cotyledon cDNA library KHCT Brassica rap... 54 5e-05 2 (EY402477) pOP-CNH00838_EST_C_1_pSK_SK CNH (Oil Palm Non-Emb... 40 5e-05 3 (U84378) Bartonella sp. sh7768ga citrate synthase (gltA) gen... 52 7e-05 2 (U84377) Bartonella sp. sh6537ga citrate synthase (gltA) gen... 52 7e-05 2 (BT002169) Arabidopsis thaliana citrate synthase-like protei... 46 8e-05 3 (AI895330) EST264773 tomato callus, TAMU Solanum lycopersicu... 54 9e-05 2 (AL353032) Arabidopsis thaliana DNA chromosome 3, BAC clone ... 48 9e-05 4 (AK227008) Arabidopsis thaliana mRNA for putative citrate sy... 44 1e-04 3 (BX825978) Arabidopsis thaliana Full-length cDNA Complete se... 46 1e-04 3 (AY099611) Arabidopsis thaliana citrate synthase-like protei... 46 1e-04 3 (DT008580) VVG057C08_762075 CabSau Cell Culture (CELu0001) V... 52 1e-04 2 (FK012367) GLQAK87TR JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 44 1e-04 2 (DQ266395) Wolbachia endosymbiont of Camponotus sayi citrate... 42 1e-04 3 (DQ266412) Wolbachia endosymbiont of Protocalliphora sialia ... 42 1e-04 3 (DQ266396) Wolbachia endosymbiont of Camponotus vafer citrat... 42 1e-04 3 (EV225199) 0107125 Brassica napus Damaged cotyledons Brassic... 48 2e-04 2 (FK012167) GLQAJ73TR JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 44 2e-04 2 (AM286415) Yersinia enterocolitica subsp. enterocolitica 808... 60 2e-04 1 (DQ365879) Ehrlichia ewingii citrate synthase (gltA) gene, p... 42 2e-04 3 (FE698316) Pv023B_M13R_G01.ab1 Phaseolus vulgaris cv Early g... 44 2e-04 2 (ER544830) 1093016148450 Global-Ocean-Sampling_GS-35-01-01-1... 46 2e-04 2 (DQ266532) Wolbachia endosymbiont of Acraea eponina GltA (gl... 42 2e-04 2 (DQ266529) Wolbachia endosymbiont of Teleogryllus taiwanemma... 42 2e-04 2 (DQ266411) Wolbachia endosymbiont of Drosophila innubila B c... 42 2e-04 2 (AF228770) Bartonella sp. 'elk-1' citrate synthase gene, par... 42 2e-04 2 (AF228768) Bartonella sp. 'cattle-1' citrate synthase gene, ... 42 2e-04 2 (EF432055) Bartonella bovis isolate N 04-927 citrate synthas... 42 2e-04 2 (EF616790) Bartonella sp. LAD 3335-2 clone s272_b20 GltA (gl... 42 2e-04 3 (EF616650) Bartonella sp. AEA10-17 clone s58_B1 GltA (gltA) ... 42 2e-04 3 (AF293394) Bartonella bovis GltA (gltA) gene, partial cds. 42 3e-04 2 (EF432056) Bartonella bovis isolate N 05-1406 citrate syntha... 42 3e-04 2 (AJ583111) Bartonella sp. MZ-rn1 partial gltA gene for citra... 38 3e-04 3 (DQ394081) Bartonella bovis isolate 37MI citrate synthase (g... 42 3e-04 2 (DQ394080) Bartonella bovis isolate 18MI citrate synthase (g... 42 3e-04 2 (DQ394079) Bartonella bovis isolate 15MI citrate synthase (g... 42 3e-04 2 (DQ394078) Bartonella bovis isolate 13MI citrate synthase (g... 42 3e-04 2 (DQ358235) Bartonella bovis isolate 31MI cytrate synthase (g... 42 3e-04 2 (DQ358234) Bartonella bovis isolate 23MI cytrate synthase (g... 42 3e-04 2 (DQ358233) Bartonella bovis isolate 20MI cytrate synthase (g... 42 3e-04 2 (DQ358232) Bartonella bovis isolate 19MI cytrate synthase (g... 42 3e-04 2 (AF071190) Bartonella sp. FC7049UT citrate synthase (gltA) g... 42 3e-04 2 (DT592010) she01-31ms4-h08 She01 Saruma henryi cDNA clone sh... 40 4e-04 3 (AY902181) Bartonella sp. RR0060-2G citrate synthase (gltA) ... 38 4e-04 3 (AY902186) Bartonella sp. RR0039-3G citrate synthase (gltA) ... 38 4e-04 3 (AY902183) Bartonella sp. RR0048-2G citrate synthase (gltA) ... 38 4e-04 3 (EL915550) INIT2_92_B10.g2_A006 G5 trophont cDNA (INIT2) Ich... 48 6e-04 2 (FE267785) CAZO6338.rev CAZO Naegleria gruberi Flagellate St... 38 6e-04 2 (AX067466) Sequence 41 from Patent WO0078968. 58 6e-04 1 (AR408762) Sequence 41 from patent US 6632636. 58 6e-04 1 (FH975011) CHO_OF6818xm03f1.ab1 CHO_OF6 Nicotiana tabacum ge... 58 6e-04 1 (FH384972) CHO_OF4751xa01f1.ab1 CHO_OF4 Nicotiana tabacum ge... 58 6e-04 1 (FH215195) CHO_OF3374xm08f1.ab1 CHO_OF3 Nicotiana tabacum ge... 58 6e-04 1 (FH027002) CHO_OF3150xp07r1.ab1 CHO_OF3 Nicotiana tabacum ge... 58 6e-04 1 (DN941997) 4244.3 Tuber Skin Solanum tuberosum cDNA clone 42... 58 6e-04 1 (AM811543) Nicotiana tabacum EST, clone nt006118060. 58 6e-04 1 (CX176161) G01_69-35_13.ab1 leaf inoculated with Marssonia p... 58 6e-04 1 (CV476856) 25698.1 Developing Tubers Solanum tuberosum cDNA ... 58 6e-04 1 (CV233992) WS01213.B21_C19 PT-GT-FL-A-3 Populus trichocarpa ... 58 6e-04 1 (CU308054) Populus EST from severe drought-stressed tension ... 58 6e-04 1 (CN212621) 26120 Suspension culture Solanum tuberosum cDNA, ... 58 6e-04 1 (BU880962) UM57TA10 Populus flower cDNA library Populus tric... 58 6e-04 1 (BU879803) UM37TF06 Populus flower cDNA library Populus tric... 58 6e-04 1 (BU830008) T002G09 Populus apical shoot cDNA library Populus... 58 6e-04 1 (BI435042) EST537803 P. infestans-challenged potato leaf, co... 58 6e-04 1 (FG548699) FSPM1387 Mixed potato plant parts cDNA library So... 58 6e-04 1 (AY360216) Rickettsia sp. ARANHA citrate synthase (gltA) gen... 44 6e-04 2 (EH790290) CNSS30338.b1_C01.ab1 CNS(LMS) yellow starthistle ... 50 6e-04 2 (EL908432) INIT2_25_B06.b1_A006 G5 trophont cDNA (INIT2) Ich... 34 6e-04 3 (EK337238) 1095467047430 Global-Ocean-Sampling_GS-31-01-01-1... 50 7e-04 2 (EK200459) 1095460054579 Global-Ocean-Sampling_GS-31-01-01-1... 46 7e-04 2 (EU014273) Bartonella sp. Af2 citrate synthase (gltA) gene, ... 50 8e-04 2 (CV736003) Cri2_14_J23_SP6 Ceratopteris Spore Library Cerato... 44 8e-04 2 (EV165772) 0142582 Brassica napus Etiolated seedlings (Uni-Z... 42 8e-04 2 (EU274654) Rickettsia sp. AL citrate synthase (gltA) gene, p... 44 9e-04 2 (AJ583136) Bartonella sp. TL-sv9 partial gltA gene for citra... 38 0.001 3 (AJ583134) Bartonella sp. TL-sv3 partial gltA gene for citra... 38 0.001 3 (AJ583133) Bartonella sp. TL-sv2 partial gltA gene for citra... 38 0.001 3 (AB444960) Bartonella sp. RJ 31-1 gltA gene for citrate synt... 44 0.001 2 (AB444959) Bartonella sp. RJ 21-1 gltA gene for citrate synt... 44 0.001 2 (AY587979) Bartonella sp. Sf3sk citrate synthase (gltA) gene... 44 0.001 2 (AY587978) Bartonella sp. Sf2sk citrate synthase (gltA) gene... 44 0.001 2 (AY914176) Bartonella sp. Sr1sk citrate synthase (gltA) gene... 44 0.001 2 (AY587975) Bartonella sp. Sr4sk citrate synthase (gltA) gene... 44 0.001 2 (EH727062) CNMM13497.b1_A15.ab1 CNM(LMS) spotted knapweed Ce... 38 0.001 3 (BE437000) EST408118 tomato breaker fruit, TIGR Solanum lyco... 50 0.002 2 (BE436330) EST407408 tomato breaker fruit, TIGR Solanum lyco... 50 0.002 2 (AY584856) Bartonella grahamii strain Far East III citrate s... 38 0.002 3 (AY584855) Bartonella grahamii strain Far East II citrate sy... 38 0.002 3 (AY584854) Bartonella grahamii strain Far East I citrate syn... 38 0.002 3 (BM064056) KS01062E09 KS01 Capsicum annuum cDNA, mRNA sequence. 50 0.002 2 (BI421394) EST532060 tomato callus, TAMU Solanum lycopersicu... 50 0.002 2 (AW441334) EST310730 tomato fruit red ripe, TAMU Solanum lyc... 50 0.002 2 (CK245846) EST729483 potato callus cDNA library, normalized ... 50 0.002 2 (EV849277) FTSAD92TF Tetrahymena thermophila SB210 cDNA libr... 54 0.002 2 (AU051884) Dictyostelium discoideum slug cDNA, clone SSC318. 56 0.002 1 (DN169453) LH__Ea05B21.f LH__Ea Solanum habrochaites cDNA cl... 50 0.002 2 (DQ266413) Wolbachia endosymbiont of Protocalliphora sialia ... 42 0.003 2 (AF228769) Bartonella sp. 'deer-1' citrate synthase gene, pa... 42 0.003 2 (DL230568) citrate synthase. 50 0.003 2 (EU549693) Bartonella sp. ED377 citrate synthase (gltA) gene... 42 0.004 2 (DQ986955) Bartonella sp. RfLC84YN citrate synthase-like (gl... 44 0.004 2 (FJ655400) Bartonella sp. Rr18771tl citrate synthase (gltA) ... 44 0.004 2 (AM489220) Vitis vinifera contig VV78X195847.9, whole genome... 52 0.004 3 (FJ492796) Bartonella sp. RT229YN citrate synthase (gltA) ge... 44 0.004 2 (AC006931) Arabidopsis thaliana chromosome 2 clone F7D19 map... 44 0.004 7 (FJ589054) Bartonella sp. RT230YN citrate synthase (gltA) ge... 44 0.004 2 (FJ492799) Bartonella sp. RT266YN citrate synthase (gltA) ge... 44 0.004 2 (ER456691) 1092963871662 Global-Ocean-Sampling_GS-35-01-01-1... 36 0.005 4 (EE093499) S7B00732 Berries 14mm with GA3 (VvS7) Vitis vinif... 52 0.006 2 (EX570476) N0386 Pisum sativum shoot apical meristem ESTs Pi... 44 0.007 2 (CF209096) CAB20004_IIa_Fa_F06 Cabernet Sauvignon Flower blo... 52 0.008 2 (CF405848) CSECS060A05_VERu0035 CabSau Berry Veraison Stage ... 52 0.008 2 (BQ792733) EST 8453 Red Grape berries Lambda TriplEx2 Librar... 52 0.009 2 (EJ314225) 1095403259230 Global-Ocean-Sampling_GS-27-01-01-1... 50 0.009 2 (AC189588) Brassica rapa subsp. pekinensis clone KBrH012N11,... 54 0.010 1 (AC234722) Brassica rapa subsp. pekinensis chromosome Linkag... 54 0.010 1 (EK377218) 1095469445673 Global-Ocean-Sampling_GS-31-01-01-1... 54 0.010 1 (EJ934739) 1093018830303 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.010 1 (EJ380810) 1092963761319 Global-Ocean-Sampling_GS-28-01-01-1... 54 0.010 1 (EE414034) 56ACAC48_UP_024_G10_16DEC2004_068 Brassica napus ... 54 0.010 1 (EE409281) 21ACACMS_UP_026_D09_06NOV2004_073 Brassica napus ... 54 0.010 1 (EE402705) 16ACDHDS_UP_013_G05_15OCT2004_035 Brassica napus ... 54 0.010 1 (DN962988) 144g12 longbai no.2 one month old leaves Brassica... 54 0.010 1 (AM390873) Brassica oleracea var. alboglabra EST, clone AAF... 54 0.010 1 (BP911686) Adiantum capillus-veneris mRNA, clone: YMU001_000... 54 0.010 1 (EV182774) 0156290 Brassica napus Etiolated seedlings (pSPOR... 54 0.010 1 (DQ114817) Uncultured Bartonella sp. from Dolichoderus conig... 54 0.010 1 (EJ930160) 1093018802092 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.010 2 (EK000834) 1093025423034 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.010 2 (Z70019) Bartonella sp. gltA gene (strain C4phy). 50 0.011 2 (Z70011) Bartonella sp. gltA gene (strain R-phy2). 50 0.011 2 (Z70022) Bartonella sp. gltA gene (strain C1phy). 50 0.011 2 (GE113721) 454GmaGlobSeed856369 Soybean Seeds Containing Glo... 44 0.011 2 (DQ676488) Bartonella rochalimae SM318006 citrate synthase (... 44 0.012 2 (DQ676484) Bartonella rochalimae Humboldt 131 citrate syntha... 44 0.012 2 (EU368000) Bartonella sp. SL-1 GltA (gltA) gene, partial cds. 44 0.012 2 (EV230611) VV_PEa12h01.g1 Vitis vinifera cv. perlette LibA V... 52 0.012 2 (BQ826280) OK-YZ-B826 Bermudagrass cv. Jackpot SSH Library C... 38 0.013 3 (FJ179388) Bartonella sp. TCE078 GltA (gltA) gene, partial cds. 40 0.014 2 (AY435120) Bartonella sp. af108nev citrate synthase (gltA) g... 44 0.015 2 (AY435119) Bartonella sp. af58nev citrate synthase (gltA) ge... 44 0.015 2 (AY435118) Bartonella sp. af54nev citrate synthase (gltA) ge... 44 0.015 2 (AY435117) Bartonella sp. af120nev citrate synthase (gltA) g... 44 0.015 2 (AY435116) Bartonella sp. af105nev citrate synthase (gltA) g... 44 0.015 2 (AY435115) Bartonella sp. af48nev citrate synthase (gltA) ge... 44 0.015 2 (AY435114) Bartonella sp. af110nev citrate synthase (gltA) g... 44 0.015 2 (AB444958) Bartonella sp. CJ 24-2 gltA gene for citrate synt... 44 0.015 2 (AF204272) Bartonella birtlesii citrate synthase (gltA) gene... 44 0.015 2 (EL409000) CFFS668.b1_G24.ab1 CFF(LMS) safflower Carthamus t... 38 0.016 3 (EL410456) CFFS8063.b1_N24.ab1 CFF(LMS) safflower Carthamus ... 38 0.016 3 (FJ667570) Bartonella sp. KM2563 citrate synthase (gltA) gen... 40 0.016 2 (FJ589049) Bartonella sp. RT209YN citrate synthase (gltA) ge... 44 0.017 2 (FJ589048) Bartonella sp. RT208YN citrate synthase (gltA) ge... 44 0.017 2 (DQ243937) Candidatus Rickettsia kotlanii strain HcH1 citrat... 40 0.017 2 (EJ104143) 1092343130902 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.018 3 (CB815405) 3529_1_73_1_B10.y_1 3529 - 2 mm ear tissue from S... 44 0.026 2 (FG811509) UCRVU04_CCNI12140_b1 Cowpea 524B Mixed Tissue and... 40 0.026 2 (DV971757) GQ0045.B3_N20 GQ004: Non-lignified secondary xyle... 36 0.027 3 (FG868345) UCRVU07_CCNP5386_b1 Cowpea UCR 779 Mixed Tissue a... 40 0.027 2 (CA408406) 3528_1_1_1_B09.y_1 3528 - Positive selection of M... 44 0.027 2 (FG811510) UCRVU04_CCNI12140_g1 Cowpea 524B Mixed Tissue and... 40 0.028 2 (FL030429) 25414939 CERES-503 Zea mays cDNA clone 1671438 5'... 44 0.028 2 (EH039793) GMSeed0058 Soybean endosperm tissue in developing... 44 0.028 2 (FK013182) GLQAP39TR JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 44 0.029 2 (EV089345) BNSCS5CT_UP_161_F02_31MAY2007_006 Brassica napus ... 46 0.030 2 (FD581736) RS3EP84JQ RS3(RT) Raphanus sativus cDNA 3', mRNA ... 44 0.031 2 (FM191773) Zea mays EST, clone ZEASTAR-C-003-C08. 44 0.031 2 (CF845405) psHB032xL24f USDA-IFAFS:Expression of Phytophthor... 44 0.032 2 (EF616711) Bartonella sp. LAD 3332-2 clone s80_B11 GltA (glt... 42 0.032 2 (CD445143) EL01N0448B04.b Endosperm_4 Zea mays cDNA, mRNA se... 44 0.032 2 (CD433089) EL01N0304C03.b Endosperm_3 Zea mays cDNA, mRNA se... 44 0.032 2 (CO465232) MZCCS20032E05.g Maize Endosperm cDNA Library Zea ... 44 0.033 2 (FF551695) MOPFD70TF MOP Vigna unguiculata cDNA 5', mRNA seq... 40 0.033 2 (FG557560) BN18DYSC_UP_053_F03_20FEB2008_021 BN18DYSC Brassi... 46 0.034 2 (EX909112) RS3CJ90JQ RS3(RT) Raphanus sativus cDNA 3', mRNA ... 44 0.034 2 (AF311966) Ehrlichia sp. EHt224 citrate synthase (gltA) gene... 36 0.034 3 (EJ898250) 1093018476593 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.035 2 (EX898802) RS2BJ93JQ RS2(RS) Raphanus sativus cDNA 3', mRNA ... 46 0.035 2 (DQ010406) Rickettsia sp. 1-227a GltA-like protein (gltA) ge... 38 0.035 2 (FF548268) MOPFD70TR MOP Vigna unguiculata cDNA 3', mRNA seq... 40 0.035 2 (EV255129) MTYCH20TF JCVI-MT1 Medicago truncatula cDNA 5', m... 44 0.035 2 (CD445899) EL01T0205A09.b Endosperm_4 Zea mays cDNA, mRNA se... 44 0.037 2 (ET041579) wDi00021 Wolbachia of Dirofilaria immitis Library... 42 0.037 2 (EJ905922) 1093018513457 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.037 2 (CO453821) MZCCL10197F04.g Maize Endosperm cDNA Library Zea ... 44 0.038 2 (EA385200) Sequence 34024 from patent US 7314974. 52 0.038 1 (ER194400) 1095522297487 Global-Ocean-Sampling_GS-33-01-01-1... 52 0.038 1 (EG672661) RCRCV15TO Castor bean cDNA library from roots, 1.... 52 0.038 1 (EG671762) RCRA965TO Castor bean cDNA library from roots, 1.... 52 0.038 1 (EG669794) RCRCE74TO Castor bean cDNA library from roots, 1.... 52 0.038 1 (EB118032) 000815AALB001638HT (AALB) Royal Gala 150 DAFB fru... 52 0.038 1 (DY667669) STRA328JX cold-stressed Fragaria vesca seedlings ... 52 0.038 1 (DY651137) PU4_plate44_A23 PU4 Prunus persica cDNA similar t... 52 0.038 1 (DY651005) PU4_plate43_C21 PU4 Prunus persica cDNA similar t... 52 0.038 1 (DY648730) PU4_plate11_J06 PU4 Prunus persica cDNA similar t... 52 0.038 1 (DW350568) PU1_plate27_N05 PU1 Prunus persica cDNA clone PU1... 52 0.038 1 (DW348875) PU1_plate7_G19 PU1 Prunus persica cDNA clone PU1_... 52 0.038 1 (DT525415) WS02045.C21_E15 PTxN-IB-N-A-11 Populus trichocarp... 52 0.038 1 (DT492596) WS02551.C21_G23 PT-MB-N-A-15 Populus trichocarpa ... 52 0.038 1 (DB907874) Populus nigra mRNA, clone: PnFL2-086_N15, 3'end. 52 0.038 1 (CV997514) Mdst6026b13.y4 Mdst Malus x domestica cDNA clone ... 52 0.038 1 (CV880925) Mdst6020a08.y3 Mdst Malus x domestica cDNA clone ... 52 0.038 1 (CV084912) Mdfrt3076m09.y1 Mdfrt Malus x domestica cDNA clon... 52 0.038 1 (CV052502) EST 11950 Half-Ripe Apricot Fruit Lambda Zap II L... 52 0.038 1 (CV051511) EST 10966 Half-Ripe Apricot Fruit Lambda Zap II L... 52 0.038 1 (CV050828) EST 10283 Half-Ripe Apricot Fruit Lambda Zap II L... 52 0.038 1 (CV049517) EST 14834 Ripe Apricot Fruit Lambda Zap II Librar... 52 0.038 1 (CV045012) EST 6719 Green Apricot Fruit Lambda Zap II Librar... 52 0.038 1 (CO414874) Mdfw2066m23.y3 Mdfw Malus x domestica cDNA clone ... 52 0.038 1 (AM291342) Prunus persica EST, clone Skin80F06. 52 0.038 1 (AM291318) Prunus persica EST, clone Skin80D05. 52 0.038 1 (AM290785) Prunus persica EST, clone Skin73A11. 52 0.038 1 (AM288004) Prunus persica EST, clone Skin38B04. 52 0.038 1 (CN877824) 020902AARA012071HT (AARA) Royal Gala partially se... 52 0.038 1 (CN579006) Mdfw2032e02.y1 Mdfw Malus x domestica cDNA clone ... 52 0.038 1 (AJ826857) Prunus persica EST, clone S39G11. 52 0.038 1 (AJ769420) Populus euphratica EST, clone P0001000001C02F1. 52 0.038 1 (CB823586) EST 4810 Ripe Apricot Fruit Lambda Zap II Library... 52 0.038 1 (CB821747) EST 2598 Half-Ripe Apricot Fruit Lambda Zap II Li... 52 0.038 1 (CB820118) EST 1110 Green Apricot Fruit Lambda Zap II Librar... 52 0.038 1 (BU044708) PP_LEa0020E04f Peach developing fruit mesocarp Pr... 52 0.038 1 (BU040616) PP_LEa0006L02f Peach developing fruit mesocarp Pr... 52 0.038 1 (BP940366) Bruguiera gymnorhiza mRNA, clone: Bg01-07_I06, 5'... 52 0.038 1 (BP934736) Populus nigra mRNA, clone: PnFL1-068_O02.r, 3'end... 52 0.038 1 (AI165505) A084p10u Hybrid aspen plasmid library Populus tre... 52 0.038 1 (FF390129) MOOBM65TF MOO Vigna unguiculata cDNA 5', mRNA seq... 52 0.038 1 (EY913906) RR3DC34TF RR3(NY) Raphanus raphanistrum subsp. ra... 52 0.038 1 (EY910056) RR3DC34JQ RR3(NY) Raphanus raphanistrum subsp. ra... 52 0.038 1 (CP000383) Cytophaga hutchinsonii ATCC 33406, complete genome. 52 0.038 1 (EU979534) Bartonella sp. Cr28649 citrate synthase (glta) ge... 44 0.038 2 (EU979531) Bartonella sp. Cr28647 citrate synthase (glta) ge... 44 0.038 2 (EJ124020) 1092343385786 Global-Ocean-Sampling_GS-27-01-01-1... 50 0.039 2 (Z70013) B.taylorii gltA gene (strain M6). 44 0.041 2 (Z70012) Bartonella sp. gltA gene (strain N40). 44 0.041 2 (DQ266531) Wolbachia endosymbiont of Protocalliphora sialia ... 42 0.041 2 (EU014274) Bartonella sp. Mo3 citrate synthase (gltA) gene, ... 44 0.041 2 (DQ266530) Wolbachia endosymbiont of Caudra cautella GltA (g... 42 0.041 2 (DQ266528) Wolbachia endosymbiont of Nasonia longicornis Glt... 42 0.041 2 (DQ266527) Wolbachia endosymbiont of Nasonia giraulti GltA (... 42 0.041 2 (EU622809) Rickettsia slovaca strain DM 26 citrate synthase ... 38 0.042 2 (AB204515) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.046 2 (AB204513) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.047 2 (AB204469) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.047 2 (AB204456) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.047 2 (AB204423) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.047 2 (ET041606) wDi00048 Wolbachia of Dirofilaria immitis Library... 42 0.047 2 (AB204418) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.048 2 (DQ792812) Uncultured Rickettsia sp. clone MG98-1 citrate sy... 38 0.049 2 (DQ792805) Uncultured Rickettsia sp. clone MG97-2 citrate sy... 38 0.049 2 (AF484070) Rickettsia slovaca citrate synthase (gltA) gene, ... 38 0.049 2 (AB204434) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.051 2 (AB204464) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (U33922) Rickettsia felis citrate synthase gene, partial cds. 38 0.052 2 (AB204496) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204483) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204478) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204477) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204476) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204475) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204468) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204467) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204465) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204463) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204461) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204459) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204455) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204454) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204436) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204435) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204433) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204430) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204429) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204424) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204422) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204421) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204417) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204416) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.052 2 (AB204419) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.053 2 (EU365689) Rickettsia heilongjiangii strain Hainan 1 citrate... 38 0.054 2 (EU380787) Rickettsia sp. GDM15 citrate synthase (gltA) gene... 38 0.054 2 (EU380783) Rickettsia sp. GDM12 citrate synthase (gltA) gene... 38 0.054 2 (EU380774) Rickettsia sp. SD1 citrate synthase (gltA) gene, ... 38 0.055 2 (EF616721) Bartonella sp. LAD 3333-2 clone s109_B13 GltA (gl... 46 0.055 2 (AB259957) Bartonella sp. Gunma 2-1 gene for citrate synthas... 44 0.055 2 (AB259956) Bartonella sp. Aomori 32-1 gltA gene for citrate ... 44 0.055 2 (AB242287) Bartonella sp. Fuji 23-1 gltA gene for citrate sy... 44 0.055 2 (Y08784) R.moreli gltA gene. 38 0.056 2 (EF392728) Rickettsia sp. RpA4 citrate synthase gene, partia... 38 0.056 2 (AY048817) Rickettsia sp. IrR/Munich citrate synthase (gltA)... 38 0.056 2 (AJ427879) Rickettsia sp. IrITA2 partial glta gene for citra... 38 0.056 2 (AF483201) Rickettsia sp. HOT2 citrate synthase (gltA) gene,... 38 0.056 2 (AF483200) Rickettsia sp. HOT1 citrate synthase (gltA) gene,... 38 0.056 2 (AF483197) Rickettsia sp. ATT citrate synthase (gltA) gene, ... 38 0.056 2 (AF129885) Rickettsia sp. DaE100R citrate synthase (gltA) ge... 38 0.056 2 (EU596564) Rickettsia monacensis strain A3-264 citrate synth... 38 0.056 2 (AB114815) Rickettsia sp. Hf151 gltA gene for citrate syntha... 38 0.056 2 (AB114812) Rickettsia sp. Hf187 gltA gene for citrate syntha... 38 0.056 2 (AB114811) Rickettsia sp. Hj126 gltA gene for citrate syntha... 38 0.056 2 (AB114806) Rickettsia sp. Hl550 gltA gene for citrate syntha... 38 0.056 2 (AB114803) Rickettsia sp. Hf332 gltA gene for citrate syntha... 38 0.056 2 (AB204428) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.056 2 (AB204427) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.056 2 (AB204426) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.056 2 (AB204425) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.056 2 (EL360585) CCEM5284.b1_H02.ab1 CCE(LMS) endive Cichorium end... 38 0.056 3 (DQ459396) Rickettsia aeschlimannii strain PoTiRav27 citrate... 38 0.056 2 (DQ459395) Rickettsia aeschlimannii strain PoTiRav25 citrate... 38 0.056 2 (DQ459394) Rickettsia aeschlimannii strain PoTiRav20 citrate... 38 0.056 2 (EH696239) CCIM8050.b1_D22.ab1 CCI(LMS) chicory Cichorium in... 38 0.057 3 (EF030949) Rickettsia sp. Koala GltA-like gene, partial sequ... 38 0.057 2 (U20243) Rickettsia conorii citrate synthase (gltA) gene, pa... 38 0.058 2 (DV970935) GQ0045.TB_L18 GQ004: Non-lignified secondary xyle... 36 0.059 3 (EF051167) Rickettsia sp. PoTiR4dt citrate synthase (gltA) g... 38 0.061 2 (EF177485) Israeli tick typhus rickettsia strain PoAnR2dt ci... 38 0.061 2 (EF177486) Rickettsia conorii strain PoAnR3dt citrate syntha... 38 0.062 2 (DQ821863) Israeli tick typhus rickettsia strain PoTiRB28 Gl... 38 0.062 2 (DQ821862) Rickettsia conorii strain PoHu4776 GltA (gltA) ge... 38 0.062 2 (DQ821861) Israeli tick typhus rickettsia strain PoHu8756 Gl... 38 0.062 2 (DQ821860) Israeli tick typhus rickettsia strain PoHu4726 Gl... 38 0.062 2 (DQ821859) Israeli tick typhus rickettsia strain PoHu8122 Gl... 38 0.062 2 (DQ821856) Rickettsia conorii strain PoTiR12 GltA (gltA) gen... 38 0.062 2 (DQ821855) Rickettsia conorii strain PoHu1258 GltA (gltA) ge... 38 0.062 2 (DQ821854) Israeli tick typhus rickettsia strain PoHu1450 Gl... 38 0.062 2 (DQ821853) Rickettsia slovaca strain PoTiR24 GltA (gltA) gen... 38 0.062 2 (DQ821852) Rickettsia slovaca strain PotiR30 GltA (gltA) gen... 38 0.062 2 (DV981965) GQ0167.B3_H05 GQ016: Primary, secondary SHOOT -N ... 36 0.062 3 (AF332584) Wolbachia pipientis citrate synthase gene, comple... 42 0.062 2 (AY548830) Rickettsia sp. D192 citrate synthase (gltA) gene,... 38 0.062 2 (AY548829) Rickettsia sp. D128 citrate synthase (gltA) gene,... 38 0.062 2 (AY548828) Rickettsia sp. D025 citrate synthase (gltA) gene,... 38 0.062 2 (AF540555) Rickettsia sp. TwKM03 citrate synthase (gltA) gen... 38 0.063 2 (DQ909073) Rickettsia japonica citrate synthase gene, partia... 38 0.063 2 (DV986124) GQ0201.B3_H22 GQ020: Clean ROOTS systems -Diurnal... 36 0.067 3 (AY590152) Rickettsia peacockii strain Skalkaho citrate synt... 38 0.071 2 (AY576904) Rickettsia peacockii strain Crestone citrate synt... 38 0.071 2 (AY189819) Rickettsia rickettsii strain Hlp#2 citrate syntha... 38 0.071 2 (AB204497) Uncultured Rickettsia sp. gene for citrate syntha... 38 0.071 2 (DQ836220) Uncultured Rickettsia sp. clone Turpan-Hd26 citra... 38 0.074 2 (AY089021) Arabidopsis thaliana clone 17416 mRNA, complete s... 44 0.074 2 (EU968842) Zea mays clone 324487 mRNA sequence. 44 0.075 2 (BT016785) Zea mays clone Contig618 mRNA sequence. 44 0.076 2 (AY105153) Zea mays PCO138377 mRNA sequence. 44 0.080 2 (AK244576) Glycine max cDNA, clone: GMFL01-07-C01. 44 0.081 2 (AJ012408) Anabaena sp. PCC 7120 gltA gene and gene encoding... 38 0.085 2 (AV555426) Arabidopsis thaliana cDNA clone:SQ014c01F, 3' end. 48 0.087 2 (CF005797) QBI14h07.xg QBI Zea mays cDNA clone QBI14h07, mRN... 42 0.094 2 (AJ583135) Bartonella sp. TL-sv7 partial gltA gene for citra... 38 0.11 2 (AF304144) Ehrlichia muris citrate synthase (gltA) gene, com... 40 0.11 2 (EU272185) Candidatus Rickettsia barbariae citrate synthase-... 38 0.11 2 (DQ423369) Rickettsia sp. PoTiRb169 citrate synthase (gltA) ... 38 0.11 2 (EJ948136) 1093018925110 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.11 2 (EU665234) Rickettsia heilongjiangensis citrate synthase (gl... 38 0.12 2 (FE231716) CAPG1366.rev CAPG Naegleria gruberi amoeba stage ... 40 0.12 2 (EU073936) Uncultured Ehrlichia sp. clone D91 citrate syntha... 40 0.12 2 (EU430246) Rickettsia sp. 518 citrate synthase-like gene, pa... 38 0.12 2 (AY129300) Rickettsia sp. DmS1 citrate synthase gene, partia... 38 0.12 2 (AY129301) Rickettsia slovaca citrate synthase gene, partial... 38 0.12 2 (EF501756) Rickettsia sp. PoTiR6dt citrate synthase (gltA) g... 38 0.12 2
>(AC115584) Dictyostelium discoideum chromosome 2 map complement(3622543-3568102) strain AX4, complete sequence. Length = 54441
Score = 1312 bits (662), Expect = 0.0 Identities = 664/665 (99%) Strand = Plus / Minus
Query: 1 atgaattaaattgttcaacagcaacaatgagacaaattgcatcaacattggttgacccat 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39620 atgaattaaattgttcaacagcaacaatgagacaaattgcatcaacattggttgacccat 39561
Query: 61 atacagcatgtgcaggtagtgcaggtgcattgtatggtccattacatggtggtgncaatg 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| Sbjct: 39560 atacagcatgtgcaggtagtgcaggtgcattgtatggtccattacatggtggtgccaatg 39501
Query: 121 aagcagtgttaagaatgttggaggcaattggaaccattgaaaatattccaaagtttattg 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39500 aagcagtgttaagaatgttggaggcaattggaaccattgaaaatattccaaagtttattg 39441
Query: 181 aacaagttaaacaaaagaaacaacgtttaatgggttttggacatcgtgtttacaaatcat 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39440 aacaagttaaacaaaagaaacaacgtttaatgggttttggacatcgtgtttacaaatcat 39381
Query: 241 atgatccacgtgctaaaatacttaaaaccgtaacaatggagatctttgcactattgggta 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39380 atgatccacgtgctaaaatacttaaaaccgtaacaatggagatctttgcactattgggta 39321
Query: 301 agaatccattgatgcaaatcgcaacagaattggaaagattggcactctctgacagctatt 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39320 agaatccattgatgcaaatcgcaacagaattggaaagattggcactctctgacagctatt 39261
Query: 361 tcatagagagacaactctatccaaatgttgatttctactctggtatcatttacaagagta 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39260 tcatagagagacaactctatccaaatgttgatttctactctggtatcatttacaagagta 39201
Query: 421 tgggtttcccaactgatatgtttccagtgttattctcaattccaagagctgctggttggt 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39200 tgggtttcccaactgatatgtttccagtgttattctcaattccaagagctgctggttggt 39141
Query: 481 tggctcattgggttgaagaattggctgatccagaacttcgtatctttagaccacgtcaaa 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39140 tggctcattgggttgaagaattggctgatccagaacttcgtatctttagaccacgtcaaa 39081
Query: 541 tctatatgggtcgtagaaatatgaattatgttccaatggatgctcgtcaagttcaacaac 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39080 tctatatgggtcgtagaaatatgaattatgttccaatggatgctcgtcaagttcaacaac 39021
Query: 601 ataatagtggtgagaaattatcctcattctcttctggtttcgatcgtcgtagagatgtct 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 39020 ataatagtggtgagaaattatcctcattctcttctggtttcgatcgtcgtagagatgtct 38961
Query: 661 ctgaa 665 ||||| Sbjct: 38960 ctgaa 38956
Score = 295 bits (149), Expect = 2e-75 Identities = 149/149 (100%) Strand = Plus / Minus
Query: 665 atgtctctgaagaactttttaattttgaagatggtgcaattccaaaaactgccactggta 724 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 38966 atgtctctgaagaactttttaattttgaagatggtgcaattccaaaaactgccactggta 38907
Query: 725 gtaaatctcaactatctgcttcaattgaacaatcttttggtgagaaaatatctccacaaa 784 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 38906 gtaaatctcaactatctgcttcaattgaacaatcttttggtgagaaaatatctccacaaa 38847
Query: 785 gtcattaaattcaaatattcatttttggt 813 ||||||||||||||||||||||||||||| Sbjct: 38846 gtcattaaattcaaatattcatttttggt 38818
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 964,014,299 Number of extensions: 56071697 Number of successful extensions: 4396019 Number of sequences better than 10.0: 1342 Length of query: 903 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 879 Effective length of database: 99,340,224,878 Effective search space: 87320057667762 Effective search space used: 87320057667762 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.29 |
Homology vs Protein |
 Query= Contig-U04201-1 (Contig-U04201-1Q) /CSM_Contig/Contig-U04201-1Q.Seq.d (903 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AF310892_1(AF310892|pid:none) Dictyostelium discoideum citrate s... 392 e-126 AB109907_1(AB109907|pid:none) Tetrahymena thermophila tgCS mRNA ... 276 9e-73 CP001099_363(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 272 1e-71 AB167269_1(AB167269|pid:none) Chlorobium limicola cit gene for c... 271 3e-71 AK120755_1(AK120755|pid:none) Oryza sativa Japonica Group cDNA c... 265 1e-69 (Q9SJH7) RecName: Full=Citrate synthase 3, peroxisomal; ... 263 8e-69 CP000909_3729(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 262 1e-68 CP001364_4025(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 262 1e-68 AB334779_1(AB334779|pid:none) Glycine max mRNA for peroxisomal c... 262 1e-68 CP000804_571(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 262 1e-68 CP001337_3621(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 261 2e-68 CP001101_1989(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 259 7e-68 CP000686_3403(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 259 7e-68 (P49299) RecName: Full=Citrate synthase, glyoxysomal; E... 258 2e-67 CT573213_108(CT573213|pid:none) Frankia alni str. ACN14A chromos... 258 3e-67 CP001110_2246(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 257 3e-67 CP000113_3427(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 257 3e-67 CP000249_82(CP000249|pid:none) Frankia sp. CcI3, complete genome. 255 1e-66 CP000820_7077(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 255 2e-66 CR954217_232(CR954217|pid:none) Ostreococcus tauri strain OTTH05... 254 4e-66 CP000108_311(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 253 6e-66 CP000096_332(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 252 1e-65 CP000386_1656(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 249 7e-65 CP000596_228(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 248 2e-64 CP000607_394(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 248 3e-64 CP000510_2465(CP000510|pid:none) Psychromonas ingrahamii 37, com... 246 1e-63 AP009153_571(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 234 2e-60 AB190318_2(AB190318|pid:none) Uncultured bacterium bzo32-1, bzo3... 230 6e-59 CP000453_2733(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 227 4e-58 AP008229_1051(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 224 4e-57 (Q9LXS7) RecName: Full=Citrate synthase 1, peroxisomal; ... 223 9e-57 CP000133_1891(CP000133|pid:none) Rhizobium etli CFN 42, complete... 222 1e-56 AY157738_1(AY157738|pid:none) Sinorhizobium fredii citrate synth... 222 2e-56 CP000394_896(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 221 2e-56 CP001389_1323(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 221 3e-56 CP000283_2831(CP000283|pid:none) Rhodopseudomonas palustris BisB... 221 3e-56 CP001191_1583(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 221 3e-56 CP000250_2803(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 220 4e-56 (P20901) RecName: Full=Citrate synthase; EC=2.3.3.1; Al... 219 8e-56 AE008923_3339(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 219 8e-56 CP000544_2220(CP000544|pid:none) Halorhodospira halophila SL1, c... 219 8e-56 CP000738_1135(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 219 8e-56 DQ631551_1(DQ631551|pid:none) Acetobacter aceti strain 1023 citr... 219 8e-56 AE008922_3186(AE008922|pid:none) Xanthomonas campestris pv. camp... 219 1e-55 CT005232_15(CT005232|pid:none) upland soil cluster alpha (USCalp... 218 2e-55 CP001562_644(CP001562|pid:none) Bartonella grahamii as4aup, comp... 218 2e-55 CP000613_1158(CP000613|pid:none) Rhodospirillum centenum SW, com... 218 3e-55 CP000697_1706(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 218 3e-55 CP000633_1875(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 218 3e-55 CR543861_2608(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 217 4e-55 (Q1RGV8) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 217 5e-55 CP001016_1390(CP001016|pid:none) Beijerinckia indica subsp. indi... 217 5e-55 AE007869_1367(AE007869|pid:none) Agrobacterium tumefaciens str. ... 216 6e-55 AE005673_1893(AE005673|pid:none) Caulobacter crescentus CB15, co... 216 8e-55 GQ255903_1(GQ255903|pid:none) Rickettsia sp. SGL01 citrate synth... 216 8e-55 (P51040) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 216 8e-55 AE017223_1070(AE017223|pid:none) Brucella abortus biovar 1 str. ... 216 8e-55 AE008917_835(AE008917|pid:none) Brucella melitensis 16M chromoso... 216 8e-55 AE009442_711(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 216 1e-54 CP000490_867(CP000490|pid:none) Paracoccus denitrificans PD1222 ... 216 1e-54 CP000911_1136(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 215 1e-54 (P51037) RecName: Full=Citrate synthase, chromosomal; E... 214 2e-54 (P51038) RecName: Full=Citrate synthase, plasmid; EC=2.... 214 2e-54 CP000943_619(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 214 3e-54 (P20902) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 214 4e-54 CP000941_806(CP000941|pid:none) Xylella fastidiosa M12, complete... 214 4e-54 AB297808_1(AB297808|pid:none) Rickettsia asiatica gltA gene for ... 213 5e-54 AB297810_1(AB297810|pid:none) Rickettsia asiatica gltA gene for ... 213 5e-54 CS431060_1(CS431060|pid:none) Sequence 89 from Patent EP1710313.... 213 7e-54 AB082520_1(AB082520|pid:none) Corynebacterium efficiens gltA2 ge... 213 7e-54 CP000542_1370(CP000542|pid:none) Verminephrobacter eiseniae EF01... 213 7e-54 CP001349_1464(CP001349|pid:none) Methylobacterium nodulans ORS 2... 213 7e-54 AM260525_822(AM260525|pid:none) Bartonella tribocorum CIP 105476... 213 7e-54 CP000774_3164(CP000774|pid:none) Parvibaculum lavamentivorans DS... 213 9e-54 CP000766_1320(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 213 9e-54 CP001100_611(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 213 9e-54 CP000781_4387(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 213 9e-54 CP000462_1871(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 212 1e-53 AF178035_1(AF178035|pid:none) Rickettsia sp. BJ-90 citrate synth... 212 1e-53 AE017282_803(AE017282|pid:none) Methylococcus capsulatus str. Ba... 212 1e-53 AB444098_1(AB444098|pid:none) Rickettsia sp. GRA-1 gltA gene for... 212 1e-53 AB359458_1(AB359458|pid:none) Rickettsia sp. TCM1 gltA gene for ... 212 1e-53 CP000644_2194(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 212 1e-53 AY743327_1(AY743327|pid:none) Rickettsia japonica GltA (gltA) ge... 212 1e-53 AM743169_3623(AM743169|pid:none) Stenotrophomonas maltophilia K2... 212 2e-53 CP000524_568(CP000524|pid:none) Bartonella bacilliformis KC583, ... 212 2e-53 CP001612_981(CP001612|pid:none) Rickettsia africae ESF-5, comple... 212 2e-53 CP000606_1644(CP000606|pid:none) Shewanella loihica PV-4, comple... 212 2e-53 DQ365803_1(DQ365803|pid:none) Rickettsia raoultii strain Marne c... 212 2e-53 CP000713_255(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 212 2e-53 AY578115_1(AY578115|pid:none) Candidatus Rickettsia principis fr... 212 2e-53 CP000319_1622(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 212 2e-53 AM889285_1830(AM889285|pid:none) Gluconacetobacter diazotrophicu... 211 2e-53 AF191033_1(AF191033|pid:none) Mycobacterium smegmatis citrate sy... 211 2e-53 CP000472_2831(CP000472|pid:none) Shewanella piezotolerans WP3, c... 211 2e-53 CP000503_1718(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 211 3e-53 AP009386_673(AP009386|pid:none) Burkholderia multivorans ATCC 17... 211 3e-53 CP000661_3063(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 211 3e-53 CP001029_5120(CP001029|pid:none) Methylobacterium populi BJ001, ... 211 4e-53 CP001321_2001(CP001321|pid:none) Haemophilus parasuis SH0165, co... 211 4e-53 (P51042) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 211 4e-53 CP000449_1391(CP000449|pid:none) Maricaulis maris MCS10, complet... 210 5e-53 CP000494_4229(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 210 5e-53 CP000851_1777(CP000851|pid:none) Shewanella pealeana ATCC 700345... 210 5e-53 DQ365806_1(DQ365806|pid:none) Candidatus Rickettsia kulagini str... 210 5e-53 CP001103_1854(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 210 5e-53 (P51034) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 210 5e-53 CP001339_1282(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 210 6e-53 CP000302_2173(CP000302|pid:none) Shewanella denitrificans OS217,... 210 6e-53 CP000469_1693(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 210 6e-53 CP000931_2475(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 210 6e-53 AE016827_2371(AE016827|pid:none) Mannheimia succiniciproducens M... 210 6e-53 CP000085_662(CP000085|pid:none) Burkholderia thailandensis E264 ... 209 8e-53 AE002098_921(AE002098|pid:none) Neisseria meningitidis MC58, com... 209 8e-53 CP000908_4619(CP000908|pid:none) Methylobacterium extorquens PA1... 209 8e-53 CP000447_2331(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 209 1e-52 U59714_1(U59714|pid:none) Rickettsia typhi Wilmington citrate sy... 209 1e-52 AF503167_1(AF503167|pid:none) Candidatus Rickettsia tarasevichia... 209 1e-52 CP000444_1692(CP000444|pid:none) Shewanella sp. MR-7, complete g... 209 1e-52 CP001504_745(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 208 2e-52 CP000615_1079(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 208 2e-52 AP009044_956(AP009044|pid:none) Corynebacterium glutamicum R DNA... 208 2e-52 CP000821_2813(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 208 2e-52 DQ402514_1(DQ402514|pid:none) Candidatus Rickettsia uilenbergi c... 208 2e-52 AE016822_1303(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 208 2e-52 CP000699_3186(CP000699|pid:none) Sphingomonas wittichii RW1, com... 208 2e-52 CP001026_722(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 208 2e-52 CP000362_2989(CP000362|pid:none) Roseobacter denitrificans OCh 1... 208 2e-52 AF210692_1(AF210692|pid:none) Rickettsia sp. California 2 citrat... 208 2e-52 CU234118_3905(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 207 3e-52 CP000471_887(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 207 3e-52 (P51041) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 207 4e-52 CU459003_710(CU459003|pid:none) Magnetospirillum gryphiswaldense... 207 4e-52 CP000020_811(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 207 4e-52 AY375161_1(AY375161|pid:none) Rickettsia bellii citrate synthase... 207 4e-52 CP001053_2769(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 207 5e-52 CP001655_2847(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 207 5e-52 CP001154_2403(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 207 5e-52 CP000271_137(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 207 5e-52 (P94325) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 207 5e-52 CP000230_1595(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 206 7e-52 U76375_1(U76375|pid:none) Bradyrhizobium japonicum citrate synth... 206 7e-52 (Q10530) RecName: Full=Citrate synthase 1; EC=2.3.3.1; ... 206 7e-52 AM408590_950(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 206 7e-52 BA000030_5337(BA000030|pid:none) Streptomyces avermitilis MA-468... 206 7e-52 DQ168981_1(DQ168981|pid:none) Rickettsia tarasevichiae strain Us... 206 9e-52 CP000031_2111(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 206 9e-52 AF394896_1(AF394896|pid:none) Rickettsia tamurae strain AT-1 cit... 206 9e-52 AE008692_1963(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 206 9e-52 CP000083_2157(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 206 1e-51 CU633749_2072(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 206 1e-51 AE016958_829(AE016958|pid:none) Mycobacterium avium subsp. parat... 206 1e-51 AY375163_1(AY375163|pid:none) Rickettsia amblyommii citrate synt... 206 1e-51 (Q59136) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 206 1e-51 AM942444_1557(AM942444|pid:none) Corynebacterium urealyticum DSM... 205 1e-51 AY362703_1(AY362703|pid:none) Rickettsia bellii citrate synthase... 205 1e-51 AM711867_2196(AM711867|pid:none) Clavibacter michiganensis subsp... 205 1e-51 CP000352_2472(CP000352|pid:none) Ralstonia metallidurans CH34, c... 205 2e-51 CP000854_4572(CP000854|pid:none) Mycobacterium marinum M, comple... 205 2e-51 (Q59742) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 205 2e-51 (Q59759) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 205 2e-51 EF219460_1(EF219460|pid:none) Rickettsia sp. IG-1 citrate syntha... 205 2e-51 CP000436_967(CP000436|pid:none) Haemophilus somnus 129PT, comple... 204 3e-51 CP000439_1587(CP000439|pid:none) Francisella tularensis subsp. n... 204 3e-51 AE017340_1502(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 204 3e-51 AE016825_1070(AE016825|pid:none) Chromobacterium violaceum ATCC ... 204 3e-51 AF1834(AF1834) citrate synthase [imported] - Nostoc sp. (strain ... 204 3e-51 CP000090_2300(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 204 3e-51 AJ012408_2(AJ012408|pid:none) Anabaena sp. PCC 7120 gltA gene an... 204 3e-51 U59712_1(U59712|pid:none) Rickettsia sp. AB bacterium citrate sy... 204 3e-51 (P51039) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 204 4e-51 U59735_1(U59735|pid:none) Rickettsia sp. Strain S citrate syntha... 204 4e-51 (Q59732) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 204 4e-51 CP000777_989(CP000777|pid:none) Leptospira biflexa serovar Patoc... 203 6e-51 CP000510_2127(CP000510|pid:none) Psychromonas ingrahamii 37, com... 203 6e-51 AF394897_1(AF394897|pid:none) Rickettsia sp. DT1 citrate synthas... 203 6e-51 AF140706_1(AF140706|pid:none) Rickettsia sp. IRS3 citrate syntha... 203 7e-51 (P42457) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 203 7e-51 AX065419_1(AX065419|pid:none) Sequence 545 from Patent WO0100844... 203 7e-51 EF219463_1(EF219463|pid:none) Rickettsia sp. TwKM01 citrate synt... 203 7e-51 AF120027_1(AF120027|pid:none) Rickettsia sp. DnS28 strain DnS28 ... 203 7e-51 CS431062_1(CS431062|pid:none) Sequence 91 from Patent EP1710313.... 202 1e-50 U59730_1(U59730|pid:none) Rickettsia conorii Seven citrate synth... 202 1e-50 (P14165) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 202 1e-50 (Q59730) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 202 1e-50 CP001087_3785(CP001087|pid:none) Desulfobacterium autotrophicum ... 202 1e-50 CP000850_2206(CP000850|pid:none) Salinispora arenicola CNS-205, ... 202 1e-50 M29728_1(M29728|pid:none) P.aeruginosa NADH-sensitive citrate sy... 202 1e-50 FM211057_109(FM211057|pid:none) Photorhabdus asymbiotica subsp. ... 202 1e-50 CP000947_1400(CP000947|pid:none) Haemophilus somnus 2336, comple... 202 1e-50 BX571863_215(BX571863|pid:none) Photorhabdus luminescens subsp. ... 202 1e-50 FM954972_2130(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 202 1e-50 CP000964_3770(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 202 1e-50 AM942759_557(AM942759|pid:none) Proteus mirabilis strain HI4320,... 202 1e-50 CP000890_1348(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 202 2e-50 (P18789) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 202 2e-50 CP001628_1466(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 202 2e-50 CP001020_1319(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 202 2e-50 AM233362_1788(AM233362|pid:none) Francisella tularensis subsp. h... 201 2e-50 CR522870_1088(CR522870|pid:none) Desulfotalea psychrophila LSv54... 201 2e-50 CP000783_2558(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 201 2e-50 CP000325_213(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 201 2e-50 U59729_1(U59729|pid:none) Rickettsia rickettsii R (Bitterroot) c... 201 2e-50 CP000749_2774(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 201 3e-50 CP000474_2673(CP000474|pid:none) Arthrobacter aurescens TC1, com... 201 3e-50 CR954246_1612(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 201 3e-50 CP001157_2880(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 201 4e-50 CP001577_287(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 201 4e-50 CP000656_1713(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 201 4e-50 AM286690_1501(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 200 5e-50 EU359285_1(EU359285|pid:none) Rickettsia helvetica isolate 20-2 ... 200 5e-50 CP000915_114(CP000915|pid:none) Francisella tularensis subsp. me... 200 6e-50 CP000667_2102(CP000667|pid:none) Salinispora tropica CNB-440, co... 200 6e-50 CP000454_2789(CP000454|pid:none) Arthrobacter sp. FB24, complete... 200 6e-50 CP000608_116(CP000608|pid:none) Francisella tularensis subsp. tu... 200 6e-50 BA000045_3012(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 200 6e-50 CP001287_1330(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 199 8e-50 BX294144_201(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 199 8e-50 DQ092215_1(DQ092215|pid:none) Rickettsia sp. IM32a citrate synth... 199 1e-49 CP000653_1212(CP000653|pid:none) Enterobacter sp. 638, complete ... 199 1e-49 (P0ABH7) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 199 1e-49 CP000514_1132(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 199 1e-49 CU928162_669(CU928162|pid:none) Escherichia coli ED1a chromosome... 199 1e-49 CP001616_2198(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 199 1e-49 A99722(A99722) citrate synthase [imported] - Escherichia coli (s... 199 1e-49 AE005174_744(AE005174|pid:none) Escherichia coli O157:H7 EDL933,... 199 1e-49 EU359287_1(EU359287|pid:none) Rickettsia helvetica isolate 41-2 ... 199 1e-49 CP000880_2135(CP000880|pid:none) Salmonella enterica subsp. ariz... 198 2e-49 CP000768_1687(CP000768|pid:none) Campylobacter jejuni subsp. doy... 198 2e-49 CP000680_2489(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 198 2e-49 EU359286_1(EU359286|pid:none) Rickettsia helvetica isolate 21-2 ... 198 2e-49 CR931997_426(CR931997|pid:none) Corynebacterium jeikeium K411 co... 198 2e-49 CP000431_4943(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 198 2e-49 AL646052_1990(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 197 3e-49 CP000712_1639(CP000712|pid:none) Pseudomonas putida F1, complete... 197 3e-49 AE017220_736(AE017220|pid:none) Salmonella enterica subsp. enter... 197 3e-49 CP000266_578(CP000266|pid:none) Shigella flexneri 5 str. 8401, c... 197 3e-49 AE015451_4141(AE015451|pid:none) Pseudomonas putida KT2440 compl... 197 3e-49 AF304143_1(AF304143|pid:none) Ehrlichia canis Oklahoma citrate s... 197 4e-49 CP000076_1687(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 197 4e-49 CU928158_2304(CU928158|pid:none) Escherichia fergusonii ATCC 354... 197 4e-49 BX248356_64(BX248356|pid:none) Corynebacterium diphtheriae gravi... 197 4e-49 CP000284_61(CP000284|pid:none) Methylobacillus flagellatus KT, c... 197 4e-49 CP000304_1836(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 196 7e-49 AM286415_2806(AM286415|pid:none) Yersinia enterocolitica subsp. ... 196 7e-49 AM181176_1774(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 196 7e-49 CU207211_1676(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 196 7e-49 CP000094_1608(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 196 7e-49 CP000822_2377(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 196 9e-49 CP000949_3494(CP000949|pid:none) Pseudomonas putida W619, comple... 196 1e-48 CR628336_1373(CR628336|pid:none) Legionella pneumophila str. Par... 196 1e-48 CP000511_4943(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 196 1e-48 AE017354_1389(AE017354|pid:none) Legionella pneumophila subsp. p... 196 1e-48 CP000285_1202(CP000285|pid:none) Chromohalobacter salexigens DSM... 195 2e-48 CP001601_765(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 195 2e-48 CP000155_4527(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 195 2e-48 AE014613_2015(AE014613|pid:none) Salmonella enterica subsp. ente... 195 2e-48 U76908_1(U76908|pid:none) Rickettsia sp. citrate synthase (gltA)... 195 2e-48 CP000100_612(CP000100|pid:none) Synechococcus elongatus PCC 7942... 195 2e-48 AP008231_912(AP008231|pid:none) Synechococcus elongatus PCC 6301... 195 2e-48 CP000655_759(CP000655|pid:none) Polynucleobacter necessarius sub... 194 3e-48 AE016853_2155(AE016853|pid:none) Pseudomonas syringae pv. tomato... 194 3e-48 CP001291_3988(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 194 3e-48 CP001322_4936(CP001322|pid:none) Desulfatibacillum alkenivorans ... 194 4e-48 AP008957_4612(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 194 4e-48 DQ513391_1(DQ513391|pid:none) Ehrlichia ruminantium strain Mara8... 193 6e-48 DQ513393_1(DQ513393|pid:none) Ehrlichia ruminantium strain Blaau... 193 6e-48 AF304146_1(AF304146|pid:none) Cowdria ruminantium citrate syntha... 193 6e-48 CP000859_26(CP000859|pid:none) Desulfococcus oleovorans Hxd3, co... 193 6e-48 DQ513394_1(DQ513394|pid:none) Ehrlichia ruminantium strain Sanka... 192 1e-47 DQ513396_1(DQ513396|pid:none) Ehrlichia ruminantium strain Seneg... 192 1e-47 AE017283_2213(AE017283|pid:none) Propionibacterium acnes KPA1712... 192 1e-47 DQ513395_1(DQ513395|pid:none) Ehrlichia ruminantium strain Pokoa... 192 1e-47 EU839565_1(EU839565|pid:none) Mycobacterium lepromatosis citrate... 192 1e-47 AJ269522_1(AJ269522|pid:none) Male-killing Rickettsia from Adali... 192 1e-47 EF077650_1(EF077650|pid:none) Israeli tick typhus rickettsia str... 192 1e-47 AJ269520_1(AJ269520|pid:none) Male-killing Rickettsia from Adali... 192 1e-47 CP000884_2413(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 191 2e-47 CP000792_1780(CP000792|pid:none) Campylobacter concisus 13826, c... 191 3e-47 DQ513392_1(DQ513392|pid:none) Ehrlichia ruminantium strain Ball3... 191 3e-47 EF177484_1(EF177484|pid:none) Israeli tick typhus rickettsia str... 191 3e-47 AM398681_1272(AM398681|pid:none) Flavobacterium psychrophilum JI... 191 4e-47 AF478130_1(AF478130|pid:none) Anaplasma platys RDC citrate synth... 191 4e-47 DQ513397_1(DQ513397|pid:none) Ehrlichia ruminantium strain Kumm1... 191 4e-47 DQ525688_1(DQ525688|pid:none) Anaplasma platys strain Dog 9 Sici... 191 4e-47 AB058782_1(AB058782|pid:none) Anaplasma platys gltA gene for cit... 191 4e-47 AY077620_1(AY077620|pid:none) Anaplasma platys isolate Okinawa c... 191 4e-47 EU516387_1(EU516387|pid:none) Anaplasma platys strain RP citrate... 191 4e-47 AF304136_1(AF304136|pid:none) Ehrlichia sp. 'HGE agent' Webster ... 190 5e-47 AM778914_28(AM778914|pid:none) Microcystis aeruginosa PCC 7806 g... 190 5e-47 CP001010_902(CP001010|pid:none) Polynucleobacter necessarius sub... 190 6e-47 AF304138_1(AF304138|pid:none) Ehrlichia phagocytophila 1602 citr... 189 8e-47 AJ269521_1(AJ269521|pid:none) Male-killing Rickettsia from Adali... 189 8e-47 AF304145_1(AF304145|pid:none) Ehrlichia sp. Yamaguchi citrate sy... 189 8e-47 AF311966_1(AF311966|pid:none) Ehrlichia sp. EHt224 citrate synth... 189 1e-46 CP000776_1457(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 189 1e-46 AF304149_1(AF304149|pid:none) Neorickettsia helminthoeca citrate... 189 1e-46 AF304139_1(AF304139|pid:none) Anaplasma marginale South Idaho ci... 189 1e-46 CU458896_933(CU458896|pid:none) Mycobacterium abscessus chromoso... 189 1e-46 CP001079_821(CP001079|pid:none) Anaplasma marginale str. Florida... 189 1e-46 CP000240_1860(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 188 2e-46 BX569695_84(BX569695|pid:none) Synechococcus sp. WH8102 complete... 188 2e-46 EU567181_1(EU567181|pid:none) Rickettsia bellii strain Pontal ci... 187 3e-46 CP000685_365(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 187 3e-46 CP001635_1413(CP001635|pid:none) Variovorax paradoxus S110 chrom... 187 5e-46 CP000267_1763(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 187 5e-46 AL954747_2375(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 186 9e-46 CU207366_2770(CU207366|pid:none) Gramella forsetii KT0803 comple... 186 1e-45 CP000487_173(CP000487|pid:none) Campylobacter fetus subsp. fetus... 185 2e-45 AF311965_1(AF311965|pid:none) Ehrlichia sp. ERm58 citrate syntha... 185 2e-45 EF102236_1(EF102236|pid:none) Rickettsia parkeri strain At24 cit... 185 2e-45 EF451001_1(EF451001|pid:none) Rickettsia sp. 'Argentina' citrate... 185 2e-45 CP000153_2092(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 184 4e-45 AE017125_1493(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 184 5e-45 DQ836220_1(DQ836220|pid:none) Uncultured Rickettsia sp. clone Tu... 184 5e-45 CP000393_1330(CP000393|pid:none) Trichodesmium erythraeum IMS101... 183 6e-45 DQ517288_1(DQ517288|pid:none) Rickettsia bellii strain An4 citra... 183 6e-45 AF332584_1(AF332584|pid:none) Wolbachia pipientis citrate syntha... 183 8e-45 CP001217_22(CP001217|pid:none) Helicobacter pylori P12, complete... 182 1e-44 DQ363995_1(DQ363995|pid:none) Ehrlichia sp. P-Mtn citrate syntha... 182 1e-44 FJ269035_1(FJ269035|pid:none) Rickettsia sp. Intervales citrate ... 182 1e-44 AM999887_982(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 182 1e-44 CP001072_24(CP001072|pid:none) Helicobacter pylori Shi470, compl... 182 1e-44 CP000241_25(CP000241|pid:none) Helicobacter pylori HPAG1, comple... 182 1e-44 AM260522_34(AM260522|pid:none) Helicobacter acinonychis str. She... 182 1e-44 CP001173_23(CP001173|pid:none) Helicobacter pylori G27, complete... 182 1e-44 BX548175_2598(BX548175|pid:none) Prochlorococcus marinus MIT9313... 182 1e-44 (P56062) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 182 1e-44 BX950851_4094(BX950851|pid:none) Erwinia carotovora subsp. atros... 182 2e-44 DQ836217_1(DQ836217|pid:none) Uncultured Rickettsia sp. clone Tu... 181 2e-44 CT978603_2276(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 181 2e-44 CP000435_2575(CP000435|pid:none) Synechococcus sp. CC9311, compl... 181 3e-44 AF304147_1(AF304147|pid:none) Ehrlichia risticii citrate synthas... 181 3e-44 EF689743_1(EF689743|pid:none) Francisella sp. TX119 GltA gene, p... 180 5e-44 CP001213_1053(CP001213|pid:none) Bifidobacterium animalis subsp.... 180 7e-44 CP001391_822(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 180 7e-44 DQ865204_1(DQ865204|pid:none) Rickettsia bellii strain HJ7 citra... 180 7e-44 AE017126_185(AE017126|pid:none) Prochlorococcus marinus subsp. m... 180 7e-44 DQ365879_1(DQ365879|pid:none) Ehrlichia ewingii citrate synthase... 180 7e-44 AF497584_1(AF497584|pid:none) Rickettsia sp. RDa420 citrate synt... 179 9e-44 AE017321_731(AE017321|pid:none) Wolbachia endosymbiont strain TR... 179 9e-44 DQ865206_1(DQ865206|pid:none) Rickettsia rhipicephali strain HJ5... 179 1e-43 AE017283_1408(AE017283|pid:none) Propionibacterium acnes KPA1712... 179 1e-43 AE017196_1032(AE017196|pid:none) Wolbachia endosymbiont of Droso... 178 2e-43 CP001230_1497(CP001230|pid:none) Persephonella marina EX-H1, com... 177 3e-43 BX548174_168(BX548174|pid:none) Prochlorococcus marinus MED4 com... 177 3e-43 CP000878_179(CP000878|pid:none) Prochlorococcus marinus str. MIT... 177 3e-43 AF304148_1(AF304148|pid:none) Ehrlichia sennetsu Miyayama citrat... 177 3e-43 AY737684_1(AY737684|pid:none) Rickettsia marmionii strain KB cit... 177 4e-43 DQ269435_1(DQ269435|pid:none) Candidatus Rickettsia gravesii cit... 177 4e-43 CP000097_277(CP000097|pid:none) Synechococcus sp. CC9902, comple... 177 4e-43 DQ115890_1(DQ115890|pid:none) Rickettsia rickettsii strain Taiac... 177 6e-43 AY189819_1(AY189819|pid:none) Rickettsia rickettsii strain Hlp#2... 176 7e-43 AB204438_1(AB204438|pid:none) Uncultured Rickettsia sp. gene for... 176 1e-42 AF516333_1(AF516333|pid:none) Rickettsia sp. RF2125 citrate synt... 176 1e-42 AY259084_1(AY259084|pid:none) Rickettsia aeschlimannii citrate s... 176 1e-42 FJ851108_1(FJ851108|pid:none) Uncultured Bartonella sp. clone Pd... 176 1e-42 DQ423370_1(DQ423370|pid:none) Rickettsia mongolotimonae strain P... 176 1e-42 AY129301_1(AY129301|pid:none) Rickettsia slovaca citrate synthas... 176 1e-42 CP000361_300(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 176 1e-42 CP000576_182(CP000576|pid:none) Prochlorococcus marinus str. MIT... 175 2e-42 CP000825_180(CP000825|pid:none) Prochlorococcus marinus str. MIT... 175 2e-42 AB204450_1(AB204450|pid:none) Uncultured Rickettsia sp. gene for... 175 2e-42 AB204497_1(AB204497|pid:none) Uncultured Rickettsia sp. gene for... 174 4e-42 CP000828_3898(CP000828|pid:none) Acaryochloris marina MBIC11017,... 174 5e-42 CT971583_2292(CT971583|pid:none) Synechococcus WH7803 complete g... 174 5e-42 DQ423369_1(DQ423369|pid:none) Rickettsia sp. PoTiRb169 citrate s... 174 5e-42 CP000552_191(CP000552|pid:none) Prochlorococcus marinus str. MIT... 173 6e-42 AJ278186_1(AJ278186|pid:none) Bartonella schoenbuchii partial gl... 173 6e-42 CP000111_172(CP000111|pid:none) Prochlorococcus marinus str. MIT... 173 8e-42 AJ564633_1(AJ564633|pid:none) Bartonella schoenbuchensis partial... 173 8e-42 FJ851112_1(FJ851112|pid:none) Uncultured Bartonella sp. clone Gs... 172 1e-41 FJ851110_1(FJ851110|pid:none) Uncultured Bartonella sp. clone Pd... 172 1e-41 AY515124_1(AY515124|pid:none) Bartonella rattimassiliensis strai... 172 1e-41 EU283829_1(EU283829|pid:none) Rickettsia sp. 801a GltA (gltA) ge... 172 2e-41 FM955313_1(FM955313|pid:none) Rickettsia endosymbiont of Deronec... 171 2e-41 FJ851114_1(FJ851114|pid:none) Uncultured Bartonella sp. clone Pd... 171 2e-41 FJ851111_1(FJ851111|pid:none) Uncultured Bartonella sp. clone Ld... 171 2e-41 FJ851107_1(FJ851107|pid:none) Uncultured Bartonella sp. clone Mm... 171 3e-41 EU359299_1(EU359299|pid:none) Rickettsia helvetica isolate 73-3-... 171 3e-41 EU543436_1(EU543436|pid:none) Uncultured Rickettsia sp. isolate ... 171 3e-41 FM955315_1(FM955315|pid:none) Rickettsia endosymbiont of Deronec... 171 3e-41 AJ278183_1(AJ278183|pid:none) Bartonella schoenbuchii partial gl... 171 4e-41 AJ278184_1(AJ278184|pid:none) Bartonella schoenbuchii partial gl... 171 4e-41 EU359293_1(EU359293|pid:none) Rickettsia helvetica isolate 41-3 ... 171 4e-41 EU430260_1(EU430260|pid:none) Rickettsia sp. 60a3 citrate syntha... 171 4e-41 AF214557_1(AF214557|pid:none) Bartonella vinsonii subsp. arupens... 170 5e-41 FJ851119_1(FJ851119|pid:none) Uncultured Bartonella sp. clone Pd... 170 7e-41 EU543437_1(EU543437|pid:none) Uncultured Rickettsia sp. isolate ... 169 1e-40 DQ788563_1(DQ788563|pid:none) Candidatus Nicolleia massiliensis ... 169 2e-40 FJ851122_1(FJ851122|pid:none) Uncultured Bartonella sp. clone Ld... 168 2e-40 CP000127_2527(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 168 2e-40 FJ851121_1(FJ851121|pid:none) Uncultured Bartonella sp. clone Ld... 168 2e-40 FJ851103_1(FJ851103|pid:none) Uncultured Bartonella sp. clone Lf... 168 3e-40 EU567177_1(EU567177|pid:none) Rickettsia sp. NOD citrate synthas... 168 3e-40 AB204453_1(AB204453|pid:none) Uncultured Rickettsia sp. gene for... 167 3e-40 FJ851117_1(FJ851117|pid:none) Uncultured Bartonella sp. clone Ld... 167 4e-40 AY515125_1(AY515125|pid:none) Bartonella rattimassiliensis strai... 167 4e-40 FJ851109_1(FJ851109|pid:none) Uncultured Bartonella sp. clone Ld... 167 4e-40 AM270183_52(AM270183|pid:none) Aspergillus niger contig An08c028... 166 1e-39 EU665236_1(EU665236|pid:none) Rickettsia monacensis citrate synt... 166 1e-39 EU665235_1(EU665235|pid:none) Rickettsia monacensis citrate synt... 166 1e-39 DQ124930_1(DQ124930|pid:none) Rickettsia sibirica citrate syntha... 166 1e-39 AB204457_1(AB204457|pid:none) Uncultured Rickettsia sp. gene for... 166 1e-39 FJ851104_1(FJ851104|pid:none) Uncultured Bartonella sp. clone Mm... 166 1e-39 BT042957_1(BT042957|pid:none) Zea mays full-length cDNA clone ZM... 165 2e-39 AJ564632_1(AJ564632|pid:none) Bartonella schoenbuchensis partial... 165 2e-39 AB204449_1(AB204449|pid:none) Uncultured Rickettsia sp. gene for... 164 3e-39 Z70016_1(Z70016|pid:none) B.grahamii gltA gene (strain V2). 164 3e-39 EU111802_1(EU111802|pid:none) Bartonella queenslandensis strain ... 164 3e-39 BX571856_1737(BX571856|pid:none) Staphylococcus aureus subsp. au... 164 3e-39 AJ938182_1554(AJ938182|pid:none) Staphylococcus aureus RF122 com... 164 3e-39 DQ191466_1(DQ191466|pid:none) Rickettsia tarasevichiae isolate D... 164 4e-39 BA000043_2736(BA000043|pid:none) Geobacillus kaustophilus HTA426... 164 4e-39 CP000702_613(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 164 4e-39 AJ583132_1(AJ583132|pid:none) Bartonella sp. SC-tr1 partial gltA... 164 4e-39 CP001656_4413(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 164 5e-39 DQ372954_1(DQ372954|pid:none) Candidatus Rickettsia antechini ci... 164 5e-39 U41752_1(U41752|pid:none) Rickettsia akari citrate synthase gene... 164 5e-39 AY584857_1(AY584857|pid:none) Bartonella grahamii strain Far Eas... 164 5e-39 AJ583120_1(AJ583120|pid:none) Bartonella sp. RP-io111 partial gl... 163 6e-39 AJ583112_1(AJ583112|pid:none) Bartonella sp. AN-nh1 partial gltA... 163 6e-39 DQ909073_1(DQ909073|pid:none) Rickettsia japonica citrate syntha... 163 6e-39 AJ583114_1(AJ583114|pid:none) Bartonella sp. AN-nh3 partial gltA... 163 6e-39 AE017333_2936(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 163 6e-39 DQ150692_1(DQ150692|pid:none) Rickettsia rickettsii strain 1995H... 163 6e-39 CP001638_2430(CP001638|pid:none) Geobacillus sp. WCH70, complete... 163 6e-39 CP000560_2528(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 163 6e-39 AJ583116_1(AJ583116|pid:none) Bartonella sp. AN-tr2 partial gltA... 163 8e-39 AJ583118_1(AJ583118|pid:none) Bartonella sp. AN-tr103 partial gl... 163 8e-39 EU111794_1(EU111794|pid:none) Bartonella rattaustraliani strain ... 163 8e-39 AJ583129_1(AJ583129|pid:none) Bartonella sp. TL-sv1 partial gltA... 163 8e-39 AF191502_1(AF191502|pid:none) Bartonella taylorii citrate syntha... 162 1e-38 EU014274_1(EU014274|pid:none) Bartonella sp. Mo3 citrate synthas... 162 1e-38 EU111796_1(EU111796|pid:none) Bartonella rattaustraliani strain ... 162 1e-38 EU111798_1(EU111798|pid:none) Bartonella queenslandensis strain ... 162 1e-38 CP000029_1231(CP000029|pid:none) Staphylococcus epidermidis RP62... 162 1e-38 AJ583119_1(AJ583119|pid:none) Bartonella sp. RP-tr109 partial gl... 162 1e-38 AY584856_1(AY584856|pid:none) Bartonella grahamii strain Far Eas... 162 1e-38 CP000557_2618(CP000557|pid:none) Geobacillus thermodenitrificans... 162 1e-38 EU111795_1(EU111795|pid:none) Bartonella rattaustraliani strain ... 162 1e-38 AY584855_1(AY584855|pid:none) Bartonella grahamii strain Far Eas... 162 1e-38 AJ583122_1(AJ583122|pid:none) Bartonella sp. MN-tr1 partial gltA... 162 2e-38 AY584854_1(AY584854|pid:none) Bartonella grahamii strain Far Eas... 162 2e-38 BA000004_3160(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 162 2e-38 AY584852_1(AY584852|pid:none) Bartonella taylorii strain Far Eas... 161 2e-38 AF022817_1(AF022817|pid:none) Rickettsia honei citrate synthase ... 161 2e-38 AY584853_1(AY584853|pid:none) Bartonella taylorii strain Far Eas... 161 2e-38 EU014272_1(EU014272|pid:none) Bartonella sp. Af1 citrate synthas... 161 2e-38 AJ583128_1(AJ583128|pid:none) Bartonella sp. MN-ga8 partial gltA... 161 3e-38 AJ583124_1(AJ583124|pid:none) Bartonella sp. MN-ko1 partial gltA... 161 3e-38 EU111793_1(EU111793|pid:none) Bartonella rattaustraliani strain ... 161 3e-38 AJ583131_1(AJ583131|pid:none) Bartonella sp. TL-sv6 partial gltA... 161 3e-38 (P51036) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 161 3e-38 DQ821857_1(DQ821857|pid:none) Rickettsia helvetica strain PoTiR4... 161 3e-38 AJ583133_1(AJ583133|pid:none) Bartonella sp. TL-sv2 partial gltA... 161 3e-38 CP000561_550(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 160 4e-38 (Q59258) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 160 4e-38 AE015929_1371(AE015929|pid:none) Staphylococcus epidermidis ATCC... 160 4e-38 CP001615_663(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 160 5e-38 (P39120) RecName: Full=Citrate synthase 2; EC=2.3.3.1; ... 160 5e-38 (P51031) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 160 5e-38 EU979534_1(EU979534|pid:none) Bartonella sp. Cr28649 citrate syn... 160 5e-38 DQ821854_1(DQ821854|pid:none) Israeli tick typhus rickettsia str... 160 5e-38 CP000922_504(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 160 5e-38 DQ821852_1(DQ821852|pid:none) Rickettsia slovaca strain PotiR30 ... 160 7e-38 AJ583127_1(AJ583127|pid:none) Bartonella sp. MN-ga18 partial glt... 159 9e-38 AP008955_1389(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 159 9e-38 EU111803_1(EU111803|pid:none) Bartonella coopersplainsensis stra... 159 9e-38 DQ423368_1(DQ423368|pid:none) Rickettsia mongolotimonae strain P... 159 9e-38 EF531339_249(EF531339|pid:none) Candidatus Chloracidobacterium t... 159 2e-37 AY094149_1(AY094149|pid:none) Rhizobium galegae citrate synthase... 159 2e-37 AY953289_1(AY953289|pid:none) Rickettsia sp. cf1and5 citrate syn... 158 2e-37 Z70012_1(Z70012|pid:none) Bartonella sp. gltA gene (strain N40). 158 3e-37 U05257_1(U05257|pid:none) Bacillus subtilis citrate synthase II ... 158 3e-37 AY445820_1(AY445820|pid:none) Rickettsia sp. TwKM02 citrate synt... 157 5e-37 EU014269_1(EU014269|pid:none) Bartonella sp. Mo2 citrate synthas... 157 5e-37 CP000813_2516(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 157 5e-37 AJ621309_1(AJ621309|pid:none) Thermoproteus tenax cis2 gene for ... 157 5e-37 AF176091_1(AF176091|pid:none) Bartonella koehlerae citrate synth... 157 6e-37 FJ589059_1(FJ589059|pid:none) Bartonella sp. RT246YN citrate syn... 157 6e-37 AY445819_1(AY445819|pid:none) Rickettsia sp. TwKM01 citrate synt... 157 6e-37 CP001229_1075(CP001229|pid:none) Sulfurihydrogenibium azorense A... 156 8e-37 FJ655392_1(FJ655392|pid:none) Bartonella sp. Bi18780tl citrate s... 156 1e-36 AY094144_1(AY094144|pid:none) Rhizobium rhizogenes strain K-Ag-3... 156 1e-36 AE009441_1166(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 156 1e-36 CP000964_4022(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 156 1e-36 FJ666758_1(FJ666758|pid:none) Rickettsia endosymbiont of Brachys... 155 1e-36 AY094151_1(AY094151|pid:none) Rhizobium etli strain CFN234 citra... 155 1e-36 FJ464239_1(FJ464239|pid:none) Bartonella sp. SM111HAIN citrate s... 155 1e-36 AI1632(AI1632) citrate synthase chain II homolog citZ [imported]... 155 1e-36 FJ666755_1(FJ666755|pid:none) Rickettsia endosymbiont of Bombyli... 155 1e-36 FJ589052_1(FJ589052|pid:none) Bartonella sp. RT218YN citrate syn... 155 1e-36 AP008934_1071(AP008934|pid:none) Staphylococcus saprophyticus su... 155 1e-36 FJ666759_1(FJ666759|pid:none) Rickettsia endosymbiont of Chrysop... 155 1e-36 FJ492784_1(FJ492784|pid:none) Bartonella sp. RT244YN citrate syn... 155 2e-36 AY902188_1(AY902188|pid:none) Bartonella sp. RR002-1E citrate sy... 155 2e-36 EU179229_1(EU179229|pid:none) Uncultured Bartonella sp. clone R2... 155 2e-36 AY902189_1(AY902189|pid:none) Bartonella sp. RR0040-2G citrate s... 155 2e-36 BA000023_641(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 155 2e-36
>AF310892_1(AF310892|pid:none) Dictyostelium discoideum citrate synthase (gltA) gene, partial cds; RacF2 (racF2) gene, complete cds; and unknown gene. Length = 247
Score = 392 bits (1006), Expect(2) = e-126 Identities = 193/194 (99%), Positives = 193/194 (99%) Frame = +3
Query: 39 ASTLVDPYTACAGSAGALYGPLHGGXNEAVLRMLEAIGTIENIPKFIEQVKQKKQRLMGF 218 ASTLVDPYTACAGSAGALYGPLHGG NEAVLRMLEAIGTIENIPKFIEQVKQKKQRLMGF Sbjct: 1 ASTLVDPYTACAGSAGALYGPLHGGGNEAVLRMLEAIGTIENIPKFIEQVKQKKQRLMGF 60
Query: 219 GHRVYKSYDPRAKILKTVTMEIFALLGKNPLMQIATELERLALSDSYFIERQLYPNVDFY 398 GHRVYKSYDPRAKILKTVTMEIFALLGKNPLMQIATELERLALSDSYFIERQLYPNVDFY Sbjct: 61 GHRVYKSYDPRAKILKTVTMEIFALLGKNPLMQIATELERLALSDSYFIERQLYPNVDFY 120
Query: 399 SGIIYKSMGFPTDMFPVLFSIPRAAGWLAHWVEELADPELRIFRPRQIYMGRRNMNYVPM 578 SGIIYKSMGFPTDMFPVLFSIPRAAGWLAHWVEELADPELRIFRPRQIYMGRRNMNYVPM Sbjct: 121 SGIIYKSMGFPTDMFPVLFSIPRAAGWLAHWVEELADPELRIFRPRQIYMGRRNMNYVPM 180
Query: 579 DARQVQQHNSGEKL 620 DARQVQQHNSGEKL Sbjct: 181 DARQVQQHNSGEKL 194
Score = 83.2 bits (204), Expect(2) = e-126 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +1
Query: 664 NVSEELFNFEDGAIPKTATGSKSQLSASIEQSFGEKISPQSH 789 +VSEELFNFEDGAIPKTATGSKSQLSASIEQSFGEKISPQSH Sbjct: 206 DVSEELFNFEDGAIPKTATGSKSQLSASIEQSFGEKISPQSH 247
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 1,487,092,104 Number of extensions: 31196357 Number of successful extensions: 81866 Number of sequences better than 10.0: 1392 Number of HSP's gapped: 79440 Number of HSP's successfully gapped: 1395 Length of query: 301 Length of database: 1,061,185,681 Length adjustment: 128 Effective length of query: 173 Effective length of database: 642,824,337 Effective search space: 111208610301 Effective search space used: 111208610301 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
 |
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
1 |
SS (DIR, S) |
3 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |