Homology vs DNA |
 Query= Contig-U05760-1 (Contig-U05760-1Q) /CSM_Contig/Contig-U05760-1Q.Seq.d (515 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AU039105) Dictyostelium discoideum slug cDNA, clone SSM389. 912 0.0 1 (AU074595) Dictyostelium discoideum slug cDNA, clone SSL335. 476 e-130 1 (AU038676) Dictyostelium discoideum slug cDNA, clone SSL335. 408 e-110 1 (DX489133) Cpl30925 Papaya Genomic DNA BAC Library Carica pa... 50 0.079 1 (CP000852) Caldivirga maquilingensis IC-167, complete genome. 50 0.079 1 (CP000771) Fervidobacterium nodosum Rt17-B1, complete genome. 50 0.079 1 (CP001034) Natranaerobius thermophilus JW/NM-WN-LF, complete... 48 0.31 1 (AQ854894) CpG2106B CpIOWAgDNA1 Cryptosporidium parvum genom... 42 0.58 2 (FC747506) CBBI3257.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 46 1.2 1 (FC733787) CBBG8157.fwd CBBG Lottia gigantea 12,15,18h embry... 46 1.2 1 (FC715842) CBBG10398.fwd CBBG Lottia gigantea 12,15,18h embr... 46 1.2 1 (EJ531809) 1092955234593 Global-Ocean-Sampling_GS-29-01-01-1... 34 3.3 2 (BD411378) Method for determining a risk of developing diabe... 44 3.9 3 (DQ117977) Biomphalaria glabrata cytidine deaminase mRNA, co... 44 4.8 1 (AC144764) Homo sapiens 3 BAC RP11-557B13 (Roswell Park Canc... 44 4.8 1 (AC114772) Homo sapiens BAC clone RP11-427H3 from 2, complet... 44 4.8 1 (AC108702) Homo sapiens 3 BAC RP11-20B7 (Roswell Park Cancer... 44 4.8 1 (AC092208) Homo sapiens BAC clone RP11-476O21 from 7, comple... 44 4.8 1 (AC021020) Homo sapiens BAC clone RP11-557B13 from 3, comple... 44 4.8 1 (AC018680) Homo sapiens BAC clone RP11-384E2 from 4, complet... 44 4.8 1 (AC162700) Bos taurus clone CH240-122M14, WORKING DRAFT SEQU... 44 4.8 1 (AC111729) Rattus norvegicus clone CH230-151K22, *** SEQUENC... 44 4.8 1 (CU914454) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 4.8 1 (AC044918) Homo sapiens chromosome 8 clone RP11-451J24 map 8... 44 4.8 1 (CU179682) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 4.8 1 (AC222255) Bos taurus clone CH240-413G11, WORKING DRAFT SEQU... 44 4.8 1 (AC186911) Microcebus murinus clone CH257-192K7, WORKING DRA... 44 4.8 1 (AC170960) Bos taurus clone CH240-253B2, WORKING DRAFT SEQUE... 44 4.8 1 (AC165816) Bos taurus clone CH240-158K4, WORKING DRAFT SEQUE... 44 4.8 1 (AC013792) Homo sapiens clone RP11-20B7, WORKING DRAFT SEQUE... 44 4.8 1 (CT349692) Sus scrofa genomic clone CH242-336L6, genomic sur... 44 4.8 1 (CC843994) NDL.22G5.T7 Notre Dame Liverpool Aedes aegypti ge... 44 4.8 1 (AG452098) Mus musculus molossinus DNA, clone:MSMg01-337E14.... 44 4.8 1 (CK989288) BgHC-6.44 BgHC Biomphalaria glabrata cDNA 5', mRN... 44 4.8 1 (CK989034) BgHC-17.83 BgHC Biomphalaria glabrata cDNA 5', mR... 44 4.8 1 (EV813802) BGBV-aae90c08.b1 Snail_EST_pSMART Biomphalaria gl... 44 4.8 1 (EV813663) BGBV-aae88a07.b1 Snail_EST_pSMART Biomphalaria gl... 44 4.8 1 (BZ866270) CH240_289K13.TJ CHORI-240 Bos taurus genomic clon... 36 5.6 2 (FH536135) CHO_OF4772xc24f1.ab1 CHO_OF4 Nicotiana tabacum ge... 34 7.7 2
>(AU039105) Dictyostelium discoideum slug cDNA, clone SSM389. Length = 510
Score = 912 bits (460), Expect = 0.0 Identities = 460/460 (100%) Strand = Plus / Plus
Query: 46 ttatagaatgaaccaagaagaattagaaaaatgtattgatgccgcccaaaacagtcaaca 105 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 46 ttatagaatgaaccaagaagaattagaaaaatgtattgatgccgcccaaaacagtcaaca 105
Query: 106 atatgctcattgtccatattctcatttcagaattggtgcagctcttttaacaagttgcgg 165 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 106 atatgctcattgtccatattctcatttcagaattggtgcagctcttttaacaagttgcgg 165
Query: 166 taaaattttcactggtgtcaatgttgaaaactcatcatatggtttaacaatctgtgctga 225 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 166 taaaattttcactggtgtcaatgttgaaaactcatcatatggtttaacaatctgtgctga 225
Query: 226 aagaactgcctacactaaagcagtaagtgagggttataaaagttttaaaggaattgttgt 285 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 226 aagaactgcctacactaaagcagtaagtgagggttataaaagttttaaaggaattgttgt 285
Query: 286 agctagtgacttaaaggatagatttattactccatgtggtgcttgcagacaatttggtgt 345 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 286 agctagtgacttaaaggatagatttattactccatgtggtgcttgcagacaatttggtgt 345
Query: 346 tgaatttggagactttgaagttgtgtgtgtcaaaccagacagaagcactttcaaaagttc 405 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 346 tgaatttggagactttgaagttgtgtgtgtcaaaccagacagaagcactttcaaaagttc 405
Query: 406 aactcataaacttcttccaggattattctctcaagaagatttaatcgctaaagctgaaca 465 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 406 aactcataaacttcttccaggattattctctcaagaagatttaatcgctaaagctgaaca 465
Query: 466 agatgaaagagaatgtaaggctcaaaattaattttgtatg 505 |||||||||||||||||||||||||||||||||||||||| Sbjct: 466 agatgaaagagaatgtaaggctcaaaattaattttgtatg 505
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 581,024,503 Number of extensions: 32487828 Number of successful extensions: 2518567 Number of sequences better than 10.0: 40 Length of query: 515 Length of database: 95,242,211,685 Length adjustment: 23 Effective length of query: 492 Effective length of database: 93,106,754,628 Effective search space: 45808523276976 Effective search space used: 45808523276976 X1: 11 (21.8 bits) S2: 21 (42.1 bits)
|
Homology vs Protein |
 Query= Contig-U05760-1 (Contig-U05760-1Q) /CSM_Contig/Contig-U05760-1Q.Seq.d (515 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
FJ426114_1(FJ426114|pid:none) Epinephelus coioides cytidine deam... 146 3e-34 DQ117977_1(DQ117977|pid:none) Biomphalaria glabrata cytidine dea... 145 6e-34 CR760377_1(CR760377|pid:none) Xenopus tropicalis finished cDNA, ... 139 4e-32 S52873_1(S52873|pid:none) cytidine deaminase [human, monocytoid ... 139 5e-32 BC054036_1(BC054036|pid:none) Homo sapiens cytidine deaminase, m... 139 5e-32 (P32320) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 137 2e-31 EU101721_1(EU101721|pid:none) Haliotis diversicolor cytidine dea... 133 2e-30 BT057600_1(BT057600|pid:none) Salmo salar clone ssal-eve-568-313... 131 8e-30 BC085561_1(BC085561|pid:none) Danio rerio zgc:103586, mRNA (cDNA... 131 8e-30 BT058380_1(BT058380|pid:none) Salmo salar clone Contig74 Cytidin... 130 1e-29 CP000771_978(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 123 3e-27 T29638(T29638) hypothetical protein F49E8.4 - Caenorhabditis ele... 119 3e-26 BT076009_1(BT076009|pid:none) Caligus rogercresseyi clone crog-e... 115 5e-25 U80980_1(U80980|pid:none) Brugia malayi cytidine deaminase (bm-c... 115 5e-25 CP000419_699(CP000419|pid:none) Streptococcus thermophilus LMD-9... 115 6e-25 CP001098_1239(CP001098|pid:none) Halothermothrix orenii H 168, c... 115 8e-25 CP000969_81(CP000969|pid:none) Thermotoga sp. RQ2, complete geno... 114 2e-24 X91065_1(X91065|pid:none) Brugia pahangi mRNA for cytidine deami... 114 2e-24 CR382139_556(CR382139|pid:none) Debaryomyces hansenii strain CBS... 112 7e-24 CP000702_81(CP000702|pid:none) Thermotoga petrophila RKU-1, comp... 111 9e-24 FM992691_603(FM992691|pid:none) Candida dubliniensis CD36 chromo... 110 2e-23 CP000922_2747(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 110 2e-23 BA000016_2016(BA000016|pid:none) Clostridium perfringens str. 13... 110 2e-23 CP000232_589(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 110 3e-23 AP006840_533(AP006840|pid:none) Symbiobacterium thermophilum IAM... 110 3e-23 CP001186_4326(CP001186|pid:none) Bacillus cereus G9842, complete... 108 6e-23 CP001175_1088(CP001175|pid:none) Listeria monocytogenes HCC23, c... 108 6e-23 AE016879_4176(AE016879|pid:none) Bacillus anthracis str. Ames, c... 108 8e-23 CP000923_393(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 108 8e-23 AP009389_894(AP009389|pid:none) Pelotomaculum thermopropionicum ... 108 8e-23 CP000227_3985(CP000227|pid:none) Bacillus cereus Q1, complete ge... 108 1e-22 CP000812_1271(CP000812|pid:none) Thermotoga lettingae TMO, compl... 107 1e-22 AM263198_1478(AM263198|pid:none) Listeria welshimeri serovar 6b ... 107 1e-22 AE017262_1467(AE017262|pid:none) Listeria monocytogenes str. 4b ... 107 2e-22 AP009049_828(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 107 2e-22 CP000919_739(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 107 2e-22 AE015927_1808(AE015927|pid:none) Clostridium tetani E88, complet... 107 2e-22 CP000936_865(CP000936|pid:none) Streptococcus pneumoniae Hungary... 107 2e-22 AE016877_4101(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 107 2e-22 AE017333_2601(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 106 3e-22 CP000023_755(CP000023|pid:none) Streptococcus thermophilus LMG 1... 106 4e-22 CP000921_1248(CP000921|pid:none) Streptococcus pneumoniae Taiwan... 106 4e-22 FM211187_738(FM211187|pid:none) Streptococcus pneumoniae ATCC 70... 106 4e-22 CP000227_1789(CP000227|pid:none) Bacillus cereus Q1, complete ge... 105 5e-22 AE008691_428(AE008691|pid:none) Thermoanaerobacter tengcongensis... 105 5e-22 CP000568_1058(CP000568|pid:none) Clostridium thermocellum ATCC 2... 105 5e-22 AE005672_796(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 105 7e-22 CP001014_42(CP001014|pid:none) Thermoproteus neutrophilus V24Sta... 105 8e-22 AE016879_1734(AE016879|pid:none) Bacillus anthracis str. Ames, c... 105 8e-22 CP000764_1411(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 104 1e-21 CP000853_1227(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 104 1e-21 CP000141_1513(CP000141|pid:none) Carboxydothermus hydrogenoforma... 104 1e-21 CP000660_45(CP000660|pid:none) Pyrobaculum arsenaticum DSM 13514... 104 1e-21 CP001176_1760(CP001176|pid:none) Bacillus cereus B4264, complete... 103 2e-21 AE009948_929(AE009948|pid:none) Streptococcus agalactiae 2603V/R... 103 2e-21 CP000560_2272(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 103 2e-21 AE014134_1495(AE014134|pid:none) Drosophila melanogaster chromos... 103 2e-21 AE016830_164(AE016830|pid:none) Enterococcus faecalis V583, comp... 103 2e-21 CP000485_1580(CP000485|pid:none) Bacillus thuringiensis str. Al ... 102 4e-21 CP001615_2375(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 102 6e-21 AE017226_1917(AE017226|pid:none) Treponema denticola ATCC 35405,... 102 7e-21 BA000043_2489(BA000043|pid:none) Geobacillus kaustophilus HTA426... 102 7e-21 CP000561_11(CP000561|pid:none) Pyrobaculum calidifontis JCM 1154... 101 9e-21 DQ489736_350(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 101 9e-21 CP001615_1223(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 101 9e-21 AM946015_932(AM946015|pid:none) Streptococcus uberis 0140J compl... 101 9e-21 CU466930_1446(CU466930|pid:none) Candidatus Cloacamonas acidamin... 101 1e-20 CP000414_387(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 101 1e-20 CP000960_695(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 100 2e-20 CP000852_722(CP000852|pid:none) Caldivirga maquilingensis IC-167... 100 2e-20 AE016877_1687(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 100 2e-20 AE009441_539(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 100 2e-20 CP000150_137(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 100 2e-20 CP000382_1580(CP000382|pid:none) Clostridium novyi NT, complete ... 100 3e-20 AP008955_2065(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 100 4e-20 CP001365_931(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 99 8e-20 CP001348_571(CP001348|pid:none) Clostridium cellulolyticum H10, ... 98 1e-19 CP000378_1579(CP000378|pid:none) Burkholderia cenocepacia AU 105... 98 1e-19 AM270061_65(AM270061|pid:none) Aspergillus niger contig An03c020... 98 1e-19 CP000557_2384(CP000557|pid:none) Geobacillus thermodenitrificans... 98 1e-19 CP000679_2232(CP000679|pid:none) Caldicellulosiruptor saccharoly... 97 2e-19 CP000826_3621(CP000826|pid:none) Serratia proteamaculans 568, co... 97 2e-19 (Q9KD53) RecName: Full=Cytidine deaminase; Short=CDA; ... 97 3e-19 CP000085_411(CP000085|pid:none) Burkholderia thailandensis E264 ... 96 4e-19 BX571966_1994(BX571966|pid:none) Burkholderia pseudomallei strai... 96 4e-19 CP001291_2698(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 96 7e-19 (Q06549) RecName: Full=Cytidine deaminase; Short=CDA; ... 96 7e-19 AM747722_730(AM747722|pid:none) Burkholderia cenocepacia J2315 c... 95 9e-19 CU928175_169(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 95 9e-19 CP001056_2891(CP001056|pid:none) Clostridium botulinum B str. Ek... 95 9e-19 AE009949_961(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 94 1e-18 CP000271_2245(CP000271|pid:none) Burkholderia xenovorans LB400 c... 94 1e-18 CP001078_2635(CP001078|pid:none) Clostridium botulinum E3 str. A... 94 1e-18 CP001103_1828(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 94 2e-18 CP000885_750(CP000885|pid:none) Clostridium phytofermentans ISDg... 94 3e-18 CP000721_3369(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 93 3e-18 G72702(G72702)probable cytidine deaminase APE1038 - Aeropyrum pe... 93 3e-18 CP000412_1007(CP000412|pid:none) Lactobacillus delbrueckii subsp... 93 3e-18 AP009153_1451(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 93 4e-18 CP000875_4566(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 92 1e-17 BX842652_238(BX842652|pid:none) Bdellovibrio bacteriovorus compl... 91 1e-17 AE017332_223(AE017332|pid:none) Mycoplasma hyopneumoniae 232, co... 91 2e-17 AM920431_104(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 91 2e-17 AE017244_159(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, c... 91 2e-17 CP001032_2646(CP001032|pid:none) Opitutus terrae PB90-1, complet... 91 2e-17 CP000423_1425(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 91 2e-17 CP001504_1567(CP001504|pid:none) Burkholderia glumae BGR1 chromo... 90 4e-17 CP001114_1309(CP001114|pid:none) Deinococcus deserti VCD115, com... 89 5e-17 AJ938182_1440(AJ938182|pid:none) Staphylococcus aureus RF122 com... 89 6e-17 CP000937_168(CP000937|pid:none) Francisella philomiragia subsp. ... 89 6e-17 AM180088_1713(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 89 8e-17 AE014134_1497(AE014134|pid:none) Drosophila melanogaster chromos... 89 8e-17 AP009552_3205(AP009552|pid:none) Microcystis aeruginosa NIES-843... 89 8e-17 CP001022_816(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 88 1e-16 CU928170_362(CU928170|pid:none) Kluyveromyces thermotolerans str... 88 1e-16 AE017243_154(AE017243|pid:none) Mycoplasma hyopneumoniae J, comp... 87 2e-16 AM778953_112(AM778953|pid:none) Microcystis aeruginosa PCC 7806 ... 87 2e-16 AE016820_248(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 87 2e-16 AP008971_735(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 86 4e-16 CP001472_1642(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 86 5e-16 CP001620_1328(CP001620|pid:none) Corynebacterium kroppenstedtii ... 86 5e-16 AP009324_1556(AP009324|pid:none) Staphylococcus aureus subsp. au... 86 5e-16 AP006585_35(AP006585|pid:none) Synechocystis sp. PCC 6803 plasmi... 85 1e-15 CP000251_618(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C... 84 2e-15 DQ311151_1(DQ311151|pid:none) Bombyx mori cytidine deaminase mRN... 84 2e-15 CP001359_650(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C... 84 2e-15 AE014134_1496(AE014134|pid:none) Drosophila melanogaster chromos... 84 2e-15 AJ426459_4(AJ426459|pid:none) Methylobacterium chloromethanicum ... 84 3e-15 BX569693_390(BX569693|pid:none) Synechococcus sp. WH8102 complet... 84 3e-15 CP000142_2707(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 84 3e-15 CP000388_785(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 83 3e-15 AM746676_5870(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 83 3e-15 CP001029_3105(CP001029|pid:none) Methylobacterium populi BJ001, ... 83 3e-15 CP000804_721(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 83 3e-15 CP001131_650(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 83 3e-15 AE017343_496(AE017343|pid:none) Cryptococcus neoformans var. neo... 82 6e-15 AP004310_108(AP004310|pid:none) Synechocystis sp. PCC 6803 plasm... 82 6e-15 AE007317_1187(AE007317|pid:none) Streptococcus pneumoniae R6, co... 82 8e-15 CP000908_2927(CP000908|pid:none) Methylobacterium extorquens PA1... 82 8e-15 AJ749949_1327(AJ749949|pid:none) Francisella tularensis subsp. t... 82 8e-15 BA000026_108(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 82 1e-14 CP000699_4022(CP000699|pid:none) Sphingomonas wittichii RW1, com... 82 1e-14 AP008934_1188(AP008934|pid:none) Staphylococcus saprophyticus su... 82 1e-14 CP000916_1729(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 81 1e-14 CP001145_475(CP001145|pid:none) Coprothermobacter proteolyticus ... 81 1e-14 CP000110_649(CP000110|pid:none) Synechococcus sp. CC9605, comple... 81 2e-14 AE016825_2570(AE016825|pid:none) Chromobacterium violaceum ATCC ... 80 2e-14 CP000686_4286(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 80 2e-14 CP000157_2190(CP000157|pid:none) Erythrobacter litoralis HTCC259... 80 3e-14 CP000493_799(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 80 3e-14 CP000356_757(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 79 9e-14 AM295250_1182(AM295250|pid:none) Staphylococcus carnosus subsp. ... 78 1e-13 CP000920_1236(CP000920|pid:none) Streptococcus pneumoniae P1031,... 78 1e-13 (P47718) RecName: Full=Cytidine deaminase; Short=CDA; ... 77 2e-13 CP001280_1757(CP001280|pid:none) Methylocella silvestris BL2, co... 77 3e-13 CP001349_499(CP001349|pid:none) Methylobacterium nodulans ORS 20... 77 3e-13 CP000661_273(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 76 4e-13 CP000248_145(CP000248|pid:none) Novosphingobium aromaticivorans ... 76 4e-13 CP000112_1457(CP000112|pid:none) Desulfovibrio desulfuricans G20... 75 7e-13 AE002152_3(AE002152|pid:none) Ureaplasma parvum serovar 3 str. A... 75 9e-13 CR380953_352(CR380953|pid:none) Candida glabrata strain CBS138 c... 75 9e-13 CP000830_823(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 75 1e-12 CR628337_1616(CR628337|pid:none) Legionella pneumophila str. Len... 75 1e-12 AM889285_2974(AM889285|pid:none) Gluconacetobacter diazotrophicu... 75 1e-12 CP000577_246(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 74 2e-12 CP000031_2865(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 74 3e-12 CP000479_4131(CP000479|pid:none) Mycobacterium avium 104, comple... 73 5e-12 CP000474_1208(CP000474|pid:none) Arthrobacter aurescens TC1, com... 73 5e-12 CP000489_2198(CP000489|pid:none) Paracoccus denitrificans PD1222... 73 5e-12 CP001184_566(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 73 5e-12 CP001389_3373(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 72 8e-12 AM236080_202(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 72 8e-12 F97374(F97374)cytidine deaminase (AJ237978) [imported] - Agrobac... 72 1e-11 AD2592(AD2592) cytidine deaminase [imported] - Agrobacterium tum... 72 1e-11 CP000140_2034(CP000140|pid:none) Parabacteroides distasonis ATCC... 71 1e-11 CP000628_257(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 71 2e-11 CU179680_117(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 71 2e-11 AE000516_3536(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 70 2e-11 CP000750_3916(CP000750|pid:none) Kineococcus radiotolerans SRS30... 70 2e-11 CP001191_4133(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 70 2e-11 CP000685_1548(CP000685|pid:none) Flavobacterium johnsoniae UW101... 70 4e-11 CP000395_625(CP000395|pid:none) Borrelia afzelii PKo, complete g... 70 4e-11 AL591688_128(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 69 5e-11 CP000013_608(CP000013|pid:none) Borrelia garinii PBi, complete g... 69 5e-11 A70177(A70177) cytidine deaminase (cdd) homolog - Lyme disease s... 69 5e-11 CP000133_183(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 69 7e-11 AP006618_957(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 69 9e-11 CU458896_3643(CU458896|pid:none) Mycobacterium abscessus chromos... 69 9e-11 AE017263_143(AE017263|pid:none) Mesoplasma florum L1 complete ge... 68 1e-10 CP001016_3001(CP001016|pid:none) Beijerinckia indica subsp. indi... 68 1e-10 CP001601_1877(CP001601|pid:none) Corynebacterium aurimucosum ATC... 68 2e-10 A87181(A87181) cytidine deaminase [imported] - Mycobacterium lep... 67 2e-10 CP000048_594(CP000048|pid:none) Borrelia hermsii DAH, complete g... 67 2e-10 (P75051) RecName: Full=Cytidine deaminase; Short=CDA; ... 67 2e-10 AE015924_26(AE015924|pid:none) Porphyromonas gingivalis W83, com... 67 2e-10 CP000910_318(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 67 3e-10 CP000264_2987(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 67 3e-10 AE017283_1694(AE017283|pid:none) Propionibacterium acnes KPA1712... 66 4e-10 CP000850_738(CP000850|pid:none) Salinispora arenicola CNS-205, c... 65 7e-10 CP000667_803(CP000667|pid:none) Salinispora tropica CNB-440, com... 65 7e-10 AE017221_383(AE017221|pid:none) Thermus thermophilus HB27, compl... 65 1e-09 CU207366_2853(CU207366|pid:none) Gramella forsetii KT0803 comple... 65 1e-09 BA000012_2428(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 64 2e-09 CR626927_1355(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 64 2e-09 BA000030_3372(BA000030|pid:none) Streptomyces avermitilis MA-468... 64 2e-09 CP000480_1626(CP000480|pid:none) Mycobacterium smegmatis str. MC... 64 2e-09 AE017245_380(AE017245|pid:none) Mycoplasma synoviae 53, complete... 64 3e-09 CP000049_593(CP000049|pid:none) Borrelia turicatae 91E135, compl... 64 3e-09 AM494954_34(AM494954|pid:none) Leishmania braziliensis chromosom... 64 3e-09 CP000976_593(CP000976|pid:none) Borrelia duttonii Ly, complete g... 64 3e-09 CP000511_1568(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 64 3e-09 CP000656_4815(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 63 4e-09 AM711867_997(AM711867|pid:none) Clavibacter michiganensis subsp.... 63 4e-09 AL445564_98(AL445564|pid:none) Mycoplasma pulmonis (strain UAB C... 63 5e-09 CP000384_1221(CP000384|pid:none) Mycobacterium sp. MCS, complete... 62 6e-09 CP001340_3105(CP001340|pid:none) Caulobacter crescentus NA1000, ... 62 8e-09 A97221(A97221) cytidine deaminase family enzyme [imported] - Clo... 62 8e-09 CP000813_1709(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 62 1e-08 CP000854_1191(CP000854|pid:none) Mycobacterium marinum M, comple... 61 1e-08 AM502235_39(AM502235|pid:none) Leishmania infantum chromosome 17. 61 1e-08 CP000325_1132(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 61 1e-08 CT005256_42(CT005256|pid:none) Leishmania major strain Friedlin,... 61 2e-08 CP000613_2214(CP000613|pid:none) Rhodospirillum centenum SW, com... 61 2e-08 CP000159_1369(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 60 2e-08 AP011115_6308(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 60 3e-08 CP000431_6190(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 60 3e-08 CP000249_673(CP000249|pid:none) Frankia sp. CcI3, complete genome. 57 2e-07 CP001047_246(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 57 2e-07 EU908847_1(EU908847|pid:none) Expression vector pDM360, complete... 57 3e-07 AB041927_1(AB041927|pid:none) Retroviral vector pCXbsr DNA, comp... 57 3e-07 (P33967) RecName: Full=Blasticidin-S deaminase; EC=3.5.... 57 3e-07 CP000227_2590(CP000227|pid:none) Bacillus cereus Q1, complete ge... 57 3e-07 AB277269_1(AB277269|pid:none) Cloning vector piMARK DNA, complet... 57 3e-07 CP001177_2729(CP001177|pid:none) Bacillus cereus AH187, complete... 55 8e-07 AL079344_12(AL079344|pid:none) Arabidopsis thaliana DNA chromoso... 55 1e-06 AF080676_4(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 55 1e-06 AF121877_4(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 55 1e-06 FB898813_1(FB898813|pid:none) Sequence 118086 from Patent WO2008... 55 1e-06 (P44325) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06 (Q87Q52) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06 AE017308_347(AE017308|pid:none) Mycoplasma mobile 163K complete ... 54 3e-06 (A5UBV9) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06 CP001321_1365(CP001321|pid:none) Haemophilus parasuis SH0165, co... 53 4e-06 (Q2NUD2) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 53 4e-06 AY085453_1(AY085453|pid:none) Arabidopsis thaliana clone 152285 ... 51 1e-05 CP000463_4726(CP000463|pid:none) Rhodopseudomonas palustris BisA... 51 1e-05 CP001600_1217(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 51 1e-05 AF134485_1(AF134485|pid:none) Arabidopsis thaliana cytidine deam... 51 1e-05 AC005917_16(AC005917|pid:none) Arabidopsis thaliana chromosome 2... 51 1e-05 CP000301_4747(CP000301|pid:none) Rhodopseudomonas palustris BisB... 51 2e-05 CR954205_40(CR954205|pid:none) Ostreococcus tauri strain OTTH059... 50 2e-05 CP000250_4246(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 50 2e-05 (Q65RG8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 50 3e-05 EF085825_1(EF085825|pid:none) Picea sitchensis clone WS0293_F20 ... 50 4e-05 BA000037_1962(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 50 4e-05 AE016795_2209(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 50 4e-05 CP000962_3355(CP000962|pid:none) Clostridium botulinum A3 str. L... 50 4e-05 (Q7MK48) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 50 4e-05 CP000585_41(CP000585|pid:none) Ostreococcus lucimarinus CCE9901 ... 50 4e-05 CP000866_1467(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 49 9e-05 FB898781_1(FB898781|pid:none) Sequence 118054 from Patent WO2008... 49 9e-05 CP000283_4147(CP000283|pid:none) Rhodopseudomonas palustris BisB... 48 1e-04 BX572596_153(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 48 2e-04 CP000817_3550(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 48 2e-04 AP006627_475(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 47 2e-04 (A5F1V7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 47 2e-04 (Q9KSM5) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 47 2e-04 AF080676_3(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 47 3e-04 DQ056661_1(DQ056661|pid:none) Arabidopsis thaliana putative cyti... 47 3e-04 CP000939_3372(CP000939|pid:none) Clostridium botulinum B1 str. O... 47 3e-04 FB898893_1(FB898893|pid:none) Sequence 118166 from Patent WO2008... 47 3e-04 AL079344_11(AL079344|pid:none) Arabidopsis thaliana DNA chromoso... 47 3e-04 AP007159_700(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 47 4e-04 CP001581_3587(CP001581|pid:none) Clostridium botulinum A2 str. K... 47 4e-04 AF080676_6(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 47 4e-04 AF121877_6(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 46 5e-04 (A3N1Z1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 46 5e-04 (Q6LRI0) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 46 6e-04 AK243606_1(AK243606|pid:none) Oryza sativa Japonica Group cDNA, ... 45 8e-04 (A8FWK2) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 45 8e-04 (A8H5H1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 45 8e-04 AM412317_251(AM412317|pid:none) Clostridium botulinum A str. ATC... 45 0.001 CP001083_251(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 45 0.001 AY634312_1(AY634312|pid:none) Homo sapiens small cytidine deamin... 45 0.001 AF121877_5(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 44 0.002 FB898771_1(FB898771|pid:none) Sequence 118044 from Patent WO2008... 44 0.003 (B0TQV3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003 (A4TKN7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003 (B8CR83) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003 AF095644_1(AF095644|pid:none) Homo sapiens cytidine deaminase (C... 43 0.004 AM286415_2650(AM286415|pid:none) Yersinia enterocolitica subsp. ... 43 0.004 (Q9CP11) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 43 0.005 (Q3IBX5) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 43 0.005 (B7NMA8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.007 AB364160_2(AB364160|pid:none) S. pombe expression vector pHIS3B ... 42 0.012 CU234118_1080(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 42 0.012 (P0C2P1) RecName: Full=Blasticidin-S deaminase; EC=3.5.... 42 0.012 (B7LVA3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.012 DQ813653_2(DQ813653|pid:none) Cloning vector pLN-ENR-GFP, comple... 42 0.012 X63144_1(X63144|pid:none) E.coli cdd gene for cytidine deaminase. 42 0.012 CP000494_6489(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 42 0.012 (B1IYC6) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.012 (B5XP65) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015 (Q083S7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015 CP000961_2031(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 41 0.015 (A8GC32) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015 (A9N6L3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020 (Q8Z5A8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020 AL939124_185(AL939124|pid:none) Streptomyces coelicolor A3(2) co... 41 0.020 (Q5PE68) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020 CP001138_2175(CP001138|pid:none) Salmonella enterica subsp. ente... 41 0.020 (A6TBN1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020 (Q32EM3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 40 0.026 (B5YW75) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 40 0.026 AM920435_1338(AM920435|pid:none) Penicillium chrysogenum Wiscons... 40 0.044 CP000252_480(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 40 0.044 AM849034_213(AM849034|pid:none) Clavibacter michiganensis subsp.... 39 0.057 (A4WCI1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 39 0.075 (A3D392) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 38 0.13 CP001015_1937(CP001015|pid:none) Streptococcus pneumoniae G54, c... 38 0.13 (Q6D3B4) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 38 0.17 EU244406_1(EU244406|pid:none) Haliotis diversicolor clone HDr4CJ... 37 0.22 CP000414_1064(CP000414|pid:none) Leuconostoc mesenteroides subsp... 37 0.22 CP001033_2035(CP001033|pid:none) Streptococcus pneumoniae CGSP14... 37 0.28 CP001323_733(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 37 0.28 CU633901_61(CU633901|pid:none) Podospora anserina genomic DNA ch... 37 0.28 (Q0HTT9) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 37 0.28 CP000023_1231(CP000023|pid:none) Streptococcus thermophilus LMG ... 37 0.37 AE007317_1877(AE007317|pid:none) Streptococcus pneumoniae R6, co... 36 0.63 AE005672_1965(AE005672|pid:none) Streptococcus pneumoniae TIGR4,... 36 0.63 DQ787200_6(DQ787200|pid:none) Cylindrospermopsis raciborskii T3 ... 34 1.8 AE017333_2142(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 34 2.4 CP000750_2378(CP000750|pid:none) Kineococcus radiotolerans SRS30... 33 3.1 DQ787201_1(DQ787201|pid:none) Anabaena circinalis AWQC131C toxin... 33 3.1 DQ364229_9(DQ364229|pid:none) Xenos vesparum mitochondrion, part... 33 5.4 AM286745_9(AM286745|pid:none) Xenos vesparum partial mitochondri... 33 5.4 CP001078_1075(CP001078|pid:none) Clostridium botulinum E3 str. A... 32 7.0 CT573213_1951(CT573213|pid:none) Frankia alni str. ACN14A chromo... 32 7.0
>FJ426114_1(FJ426114|pid:none) Epinephelus coioides cytidine deaminase mRNA, partial cds. Length = 176
Score = 146 bits (369), Expect = 3e-34 Identities = 74/136 (54%), Positives = 98/136 (72%), Gaps = 1/136 (0%) Frame = +2
Query: 53 MNQEELEKCIDAAQNSQQYAHCPYSHFRIGAALLTSCGKIFTGVNVENSSYGLTICAERT 232 ++QE +++ I +Q ++Q A+CPYS FR+GAALLT +FTG NVEN+ Y L +CAERT Sbjct: 32 LSQETVKRLILQSQKAKQQAYCPYSKFRVGAALLTLDNCVFTGCNVENACYNLGLCAERT 91
Query: 233 AYTKAVSEGYKSFKGIVVASDLKDRFITPCGACRQFGVEFG-DFEVVCVKPDRSTFKSST 409 A +KAVSEGY+SFK I +ASDL D+FI+PCG CRQF EFG +++V KPD S K + Sbjct: 92 AISKAVSEGYRSFKAIAIASDLNDQFISPCGGCRQFIREFGSNWDVYLSKPDGSYLKMTV 151
Query: 410 HKLLPGLFSQEDLIAK 457 +LLP F E+L K Sbjct: 152 DELLPVSFGPEELSMK 167
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 816,465,385 Number of extensions: 15868248 Number of successful extensions: 45128 Number of sequences better than 10.0: 338 Number of HSP's gapped: 44719 Number of HSP's successfully gapped: 375 Length of query: 171 Length of database: 1,040,966,779 Length adjustment: 119 Effective length of query: 52 Effective length of database: 659,656,864 Effective search space: 34302156928 Effective search space used: 34302156928 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 30 (16.2 bits)
|