| Homology vs DNA |
 Query= Contig-U05760-1 (Contig-U05760-1Q) /CSM_Contig/Contig-U05760-1Q.Seq.d
(515 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU039105) Dictyostelium discoideum slug cDNA, clone SSM389. 912 0.0 1
(AU074595) Dictyostelium discoideum slug cDNA, clone SSL335. 476 e-130 1
(AU038676) Dictyostelium discoideum slug cDNA, clone SSL335. 408 e-110 1
(DX489133) Cpl30925 Papaya Genomic DNA BAC Library Carica pa... 50 0.079 1
(CP000852) Caldivirga maquilingensis IC-167, complete genome. 50 0.079 1
(CP000771) Fervidobacterium nodosum Rt17-B1, complete genome. 50 0.079 1
(CP001034) Natranaerobius thermophilus JW/NM-WN-LF, complete... 48 0.31 1
(AQ854894) CpG2106B CpIOWAgDNA1 Cryptosporidium parvum genom... 42 0.58 2
(FC747506) CBBI3257.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 46 1.2 1
(FC733787) CBBG8157.fwd CBBG Lottia gigantea 12,15,18h embry... 46 1.2 1
(FC715842) CBBG10398.fwd CBBG Lottia gigantea 12,15,18h embr... 46 1.2 1
(EJ531809) 1092955234593 Global-Ocean-Sampling_GS-29-01-01-1... 34 3.3 2
(BD411378) Method for determining a risk of developing diabe... 44 3.9 3
(DQ117977) Biomphalaria glabrata cytidine deaminase mRNA, co... 44 4.8 1
(AC144764) Homo sapiens 3 BAC RP11-557B13 (Roswell Park Canc... 44 4.8 1
(AC114772) Homo sapiens BAC clone RP11-427H3 from 2, complet... 44 4.8 1
(AC108702) Homo sapiens 3 BAC RP11-20B7 (Roswell Park Cancer... 44 4.8 1
(AC092208) Homo sapiens BAC clone RP11-476O21 from 7, comple... 44 4.8 1
(AC021020) Homo sapiens BAC clone RP11-557B13 from 3, comple... 44 4.8 1
(AC018680) Homo sapiens BAC clone RP11-384E2 from 4, complet... 44 4.8 1
(AC162700) Bos taurus clone CH240-122M14, WORKING DRAFT SEQU... 44 4.8 1
(AC111729) Rattus norvegicus clone CH230-151K22, *** SEQUENC... 44 4.8 1
(CU914454) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 4.8 1
(AC044918) Homo sapiens chromosome 8 clone RP11-451J24 map 8... 44 4.8 1
(CU179682) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 4.8 1
(AC222255) Bos taurus clone CH240-413G11, WORKING DRAFT SEQU... 44 4.8 1
(AC186911) Microcebus murinus clone CH257-192K7, WORKING DRA... 44 4.8 1
(AC170960) Bos taurus clone CH240-253B2, WORKING DRAFT SEQUE... 44 4.8 1
(AC165816) Bos taurus clone CH240-158K4, WORKING DRAFT SEQUE... 44 4.8 1
(AC013792) Homo sapiens clone RP11-20B7, WORKING DRAFT SEQUE... 44 4.8 1
(CT349692) Sus scrofa genomic clone CH242-336L6, genomic sur... 44 4.8 1
(CC843994) NDL.22G5.T7 Notre Dame Liverpool Aedes aegypti ge... 44 4.8 1
(AG452098) Mus musculus molossinus DNA, clone:MSMg01-337E14.... 44 4.8 1
(CK989288) BgHC-6.44 BgHC Biomphalaria glabrata cDNA 5', mRN... 44 4.8 1
(CK989034) BgHC-17.83 BgHC Biomphalaria glabrata cDNA 5', mR... 44 4.8 1
(EV813802) BGBV-aae90c08.b1 Snail_EST_pSMART Biomphalaria gl... 44 4.8 1
(EV813663) BGBV-aae88a07.b1 Snail_EST_pSMART Biomphalaria gl... 44 4.8 1
(BZ866270) CH240_289K13.TJ CHORI-240 Bos taurus genomic clon... 36 5.6 2
(FH536135) CHO_OF4772xc24f1.ab1 CHO_OF4 Nicotiana tabacum ge... 34 7.7 2
>(AU039105) Dictyostelium discoideum slug cDNA, clone SSM389.
Length = 510
Score = 912 bits (460), Expect = 0.0
Identities = 460/460 (100%)
Strand = Plus / Plus
Query: 46 ttatagaatgaaccaagaagaattagaaaaatgtattgatgccgcccaaaacagtcaaca 105
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 46 ttatagaatgaaccaagaagaattagaaaaatgtattgatgccgcccaaaacagtcaaca 105
Query: 106 atatgctcattgtccatattctcatttcagaattggtgcagctcttttaacaagttgcgg 165
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 106 atatgctcattgtccatattctcatttcagaattggtgcagctcttttaacaagttgcgg 165
Query: 166 taaaattttcactggtgtcaatgttgaaaactcatcatatggtttaacaatctgtgctga 225
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 166 taaaattttcactggtgtcaatgttgaaaactcatcatatggtttaacaatctgtgctga 225
Query: 226 aagaactgcctacactaaagcagtaagtgagggttataaaagttttaaaggaattgttgt 285
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 226 aagaactgcctacactaaagcagtaagtgagggttataaaagttttaaaggaattgttgt 285
Query: 286 agctagtgacttaaaggatagatttattactccatgtggtgcttgcagacaatttggtgt 345
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 286 agctagtgacttaaaggatagatttattactccatgtggtgcttgcagacaatttggtgt 345
Query: 346 tgaatttggagactttgaagttgtgtgtgtcaaaccagacagaagcactttcaaaagttc 405
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 346 tgaatttggagactttgaagttgtgtgtgtcaaaccagacagaagcactttcaaaagttc 405
Query: 406 aactcataaacttcttccaggattattctctcaagaagatttaatcgctaaagctgaaca 465
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 406 aactcataaacttcttccaggattattctctcaagaagatttaatcgctaaagctgaaca 465
Query: 466 agatgaaagagaatgtaaggctcaaaattaattttgtatg 505
||||||||||||||||||||||||||||||||||||||||
Sbjct: 466 agatgaaagagaatgtaaggctcaaaattaattttgtatg 505
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 581,024,503
Number of extensions: 32487828
Number of successful extensions: 2518567
Number of sequences better than 10.0: 40
Length of query: 515
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 492
Effective length of database: 93,106,754,628
Effective search space: 45808523276976
Effective search space used: 45808523276976
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
|
| Homology vs Protein |
Query= Contig-U05760-1 (Contig-U05760-1Q) /CSM_Contig/Contig-U05760-1Q.Seq.d
(515 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
FJ426114_1(FJ426114|pid:none) Epinephelus coioides cytidine deam... 146 3e-34
DQ117977_1(DQ117977|pid:none) Biomphalaria glabrata cytidine dea... 145 6e-34
CR760377_1(CR760377|pid:none) Xenopus tropicalis finished cDNA, ... 139 4e-32
S52873_1(S52873|pid:none) cytidine deaminase [human, monocytoid ... 139 5e-32
BC054036_1(BC054036|pid:none) Homo sapiens cytidine deaminase, m... 139 5e-32
(P32320) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 137 2e-31
EU101721_1(EU101721|pid:none) Haliotis diversicolor cytidine dea... 133 2e-30
BT057600_1(BT057600|pid:none) Salmo salar clone ssal-eve-568-313... 131 8e-30
BC085561_1(BC085561|pid:none) Danio rerio zgc:103586, mRNA (cDNA... 131 8e-30
BT058380_1(BT058380|pid:none) Salmo salar clone Contig74 Cytidin... 130 1e-29
CP000771_978(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 123 3e-27
T29638(T29638) hypothetical protein F49E8.4 - Caenorhabditis ele... 119 3e-26
BT076009_1(BT076009|pid:none) Caligus rogercresseyi clone crog-e... 115 5e-25
U80980_1(U80980|pid:none) Brugia malayi cytidine deaminase (bm-c... 115 5e-25
CP000419_699(CP000419|pid:none) Streptococcus thermophilus LMD-9... 115 6e-25
CP001098_1239(CP001098|pid:none) Halothermothrix orenii H 168, c... 115 8e-25
CP000969_81(CP000969|pid:none) Thermotoga sp. RQ2, complete geno... 114 2e-24
X91065_1(X91065|pid:none) Brugia pahangi mRNA for cytidine deami... 114 2e-24
CR382139_556(CR382139|pid:none) Debaryomyces hansenii strain CBS... 112 7e-24
CP000702_81(CP000702|pid:none) Thermotoga petrophila RKU-1, comp... 111 9e-24
FM992691_603(FM992691|pid:none) Candida dubliniensis CD36 chromo... 110 2e-23
CP000922_2747(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 110 2e-23
BA000016_2016(BA000016|pid:none) Clostridium perfringens str. 13... 110 2e-23
CP000232_589(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 110 3e-23
AP006840_533(AP006840|pid:none) Symbiobacterium thermophilum IAM... 110 3e-23
CP001186_4326(CP001186|pid:none) Bacillus cereus G9842, complete... 108 6e-23
CP001175_1088(CP001175|pid:none) Listeria monocytogenes HCC23, c... 108 6e-23
AE016879_4176(AE016879|pid:none) Bacillus anthracis str. Ames, c... 108 8e-23
CP000923_393(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 108 8e-23
AP009389_894(AP009389|pid:none) Pelotomaculum thermopropionicum ... 108 8e-23
CP000227_3985(CP000227|pid:none) Bacillus cereus Q1, complete ge... 108 1e-22
CP000812_1271(CP000812|pid:none) Thermotoga lettingae TMO, compl... 107 1e-22
AM263198_1478(AM263198|pid:none) Listeria welshimeri serovar 6b ... 107 1e-22
AE017262_1467(AE017262|pid:none) Listeria monocytogenes str. 4b ... 107 2e-22
AP009049_828(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 107 2e-22
CP000919_739(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 107 2e-22
AE015927_1808(AE015927|pid:none) Clostridium tetani E88, complet... 107 2e-22
CP000936_865(CP000936|pid:none) Streptococcus pneumoniae Hungary... 107 2e-22
AE016877_4101(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 107 2e-22
AE017333_2601(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 106 3e-22
CP000023_755(CP000023|pid:none) Streptococcus thermophilus LMG 1... 106 4e-22
CP000921_1248(CP000921|pid:none) Streptococcus pneumoniae Taiwan... 106 4e-22
FM211187_738(FM211187|pid:none) Streptococcus pneumoniae ATCC 70... 106 4e-22
CP000227_1789(CP000227|pid:none) Bacillus cereus Q1, complete ge... 105 5e-22
AE008691_428(AE008691|pid:none) Thermoanaerobacter tengcongensis... 105 5e-22
CP000568_1058(CP000568|pid:none) Clostridium thermocellum ATCC 2... 105 5e-22
AE005672_796(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 105 7e-22
CP001014_42(CP001014|pid:none) Thermoproteus neutrophilus V24Sta... 105 8e-22
AE016879_1734(AE016879|pid:none) Bacillus anthracis str. Ames, c... 105 8e-22
CP000764_1411(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 104 1e-21
CP000853_1227(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 104 1e-21
CP000141_1513(CP000141|pid:none) Carboxydothermus hydrogenoforma... 104 1e-21
CP000660_45(CP000660|pid:none) Pyrobaculum arsenaticum DSM 13514... 104 1e-21
CP001176_1760(CP001176|pid:none) Bacillus cereus B4264, complete... 103 2e-21
AE009948_929(AE009948|pid:none) Streptococcus agalactiae 2603V/R... 103 2e-21
CP000560_2272(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 103 2e-21
AE014134_1495(AE014134|pid:none) Drosophila melanogaster chromos... 103 2e-21
AE016830_164(AE016830|pid:none) Enterococcus faecalis V583, comp... 103 2e-21
CP000485_1580(CP000485|pid:none) Bacillus thuringiensis str. Al ... 102 4e-21
CP001615_2375(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 102 6e-21
AE017226_1917(AE017226|pid:none) Treponema denticola ATCC 35405,... 102 7e-21
BA000043_2489(BA000043|pid:none) Geobacillus kaustophilus HTA426... 102 7e-21
CP000561_11(CP000561|pid:none) Pyrobaculum calidifontis JCM 1154... 101 9e-21
DQ489736_350(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 101 9e-21
CP001615_1223(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 101 9e-21
AM946015_932(AM946015|pid:none) Streptococcus uberis 0140J compl... 101 9e-21
CU466930_1446(CU466930|pid:none) Candidatus Cloacamonas acidamin... 101 1e-20
CP000414_387(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 101 1e-20
CP000960_695(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 100 2e-20
CP000852_722(CP000852|pid:none) Caldivirga maquilingensis IC-167... 100 2e-20
AE016877_1687(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 100 2e-20
AE009441_539(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 100 2e-20
CP000150_137(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 100 2e-20
CP000382_1580(CP000382|pid:none) Clostridium novyi NT, complete ... 100 3e-20
AP008955_2065(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 100 4e-20
CP001365_931(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 99 8e-20
CP001348_571(CP001348|pid:none) Clostridium cellulolyticum H10, ... 98 1e-19
CP000378_1579(CP000378|pid:none) Burkholderia cenocepacia AU 105... 98 1e-19
AM270061_65(AM270061|pid:none) Aspergillus niger contig An03c020... 98 1e-19
CP000557_2384(CP000557|pid:none) Geobacillus thermodenitrificans... 98 1e-19
CP000679_2232(CP000679|pid:none) Caldicellulosiruptor saccharoly... 97 2e-19
CP000826_3621(CP000826|pid:none) Serratia proteamaculans 568, co... 97 2e-19
(Q9KD53) RecName: Full=Cytidine deaminase; Short=CDA; ... 97 3e-19
CP000085_411(CP000085|pid:none) Burkholderia thailandensis E264 ... 96 4e-19
BX571966_1994(BX571966|pid:none) Burkholderia pseudomallei strai... 96 4e-19
CP001291_2698(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 96 7e-19
(Q06549) RecName: Full=Cytidine deaminase; Short=CDA; ... 96 7e-19
AM747722_730(AM747722|pid:none) Burkholderia cenocepacia J2315 c... 95 9e-19
CU928175_169(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 95 9e-19
CP001056_2891(CP001056|pid:none) Clostridium botulinum B str. Ek... 95 9e-19
AE009949_961(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 94 1e-18
CP000271_2245(CP000271|pid:none) Burkholderia xenovorans LB400 c... 94 1e-18
CP001078_2635(CP001078|pid:none) Clostridium botulinum E3 str. A... 94 1e-18
CP001103_1828(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 94 2e-18
CP000885_750(CP000885|pid:none) Clostridium phytofermentans ISDg... 94 3e-18
CP000721_3369(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 93 3e-18
G72702(G72702)probable cytidine deaminase APE1038 - Aeropyrum pe... 93 3e-18
CP000412_1007(CP000412|pid:none) Lactobacillus delbrueckii subsp... 93 3e-18
AP009153_1451(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 93 4e-18
CP000875_4566(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 92 1e-17
BX842652_238(BX842652|pid:none) Bdellovibrio bacteriovorus compl... 91 1e-17
AE017332_223(AE017332|pid:none) Mycoplasma hyopneumoniae 232, co... 91 2e-17
AM920431_104(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 91 2e-17
AE017244_159(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, c... 91 2e-17
CP001032_2646(CP001032|pid:none) Opitutus terrae PB90-1, complet... 91 2e-17
CP000423_1425(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 91 2e-17
CP001504_1567(CP001504|pid:none) Burkholderia glumae BGR1 chromo... 90 4e-17
CP001114_1309(CP001114|pid:none) Deinococcus deserti VCD115, com... 89 5e-17
AJ938182_1440(AJ938182|pid:none) Staphylococcus aureus RF122 com... 89 6e-17
CP000937_168(CP000937|pid:none) Francisella philomiragia subsp. ... 89 6e-17
AM180088_1713(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 89 8e-17
AE014134_1497(AE014134|pid:none) Drosophila melanogaster chromos... 89 8e-17
AP009552_3205(AP009552|pid:none) Microcystis aeruginosa NIES-843... 89 8e-17
CP001022_816(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 88 1e-16
CU928170_362(CU928170|pid:none) Kluyveromyces thermotolerans str... 88 1e-16
AE017243_154(AE017243|pid:none) Mycoplasma hyopneumoniae J, comp... 87 2e-16
AM778953_112(AM778953|pid:none) Microcystis aeruginosa PCC 7806 ... 87 2e-16
AE016820_248(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 87 2e-16
AP008971_735(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 86 4e-16
CP001472_1642(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 86 5e-16
CP001620_1328(CP001620|pid:none) Corynebacterium kroppenstedtii ... 86 5e-16
AP009324_1556(AP009324|pid:none) Staphylococcus aureus subsp. au... 86 5e-16
AP006585_35(AP006585|pid:none) Synechocystis sp. PCC 6803 plasmi... 85 1e-15
CP000251_618(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C... 84 2e-15
DQ311151_1(DQ311151|pid:none) Bombyx mori cytidine deaminase mRN... 84 2e-15
CP001359_650(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C... 84 2e-15
AE014134_1496(AE014134|pid:none) Drosophila melanogaster chromos... 84 2e-15
AJ426459_4(AJ426459|pid:none) Methylobacterium chloromethanicum ... 84 3e-15
BX569693_390(BX569693|pid:none) Synechococcus sp. WH8102 complet... 84 3e-15
CP000142_2707(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 84 3e-15
CP000388_785(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 83 3e-15
AM746676_5870(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 83 3e-15
CP001029_3105(CP001029|pid:none) Methylobacterium populi BJ001, ... 83 3e-15
CP000804_721(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 83 3e-15
CP001131_650(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 83 3e-15
AE017343_496(AE017343|pid:none) Cryptococcus neoformans var. neo... 82 6e-15
AP004310_108(AP004310|pid:none) Synechocystis sp. PCC 6803 plasm... 82 6e-15
AE007317_1187(AE007317|pid:none) Streptococcus pneumoniae R6, co... 82 8e-15
CP000908_2927(CP000908|pid:none) Methylobacterium extorquens PA1... 82 8e-15
AJ749949_1327(AJ749949|pid:none) Francisella tularensis subsp. t... 82 8e-15
BA000026_108(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 82 1e-14
CP000699_4022(CP000699|pid:none) Sphingomonas wittichii RW1, com... 82 1e-14
AP008934_1188(AP008934|pid:none) Staphylococcus saprophyticus su... 82 1e-14
CP000916_1729(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 81 1e-14
CP001145_475(CP001145|pid:none) Coprothermobacter proteolyticus ... 81 1e-14
CP000110_649(CP000110|pid:none) Synechococcus sp. CC9605, comple... 81 2e-14
AE016825_2570(AE016825|pid:none) Chromobacterium violaceum ATCC ... 80 2e-14
CP000686_4286(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 80 2e-14
CP000157_2190(CP000157|pid:none) Erythrobacter litoralis HTCC259... 80 3e-14
CP000493_799(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 80 3e-14
CP000356_757(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 79 9e-14
AM295250_1182(AM295250|pid:none) Staphylococcus carnosus subsp. ... 78 1e-13
CP000920_1236(CP000920|pid:none) Streptococcus pneumoniae P1031,... 78 1e-13
(P47718) RecName: Full=Cytidine deaminase; Short=CDA; ... 77 2e-13
CP001280_1757(CP001280|pid:none) Methylocella silvestris BL2, co... 77 3e-13
CP001349_499(CP001349|pid:none) Methylobacterium nodulans ORS 20... 77 3e-13
CP000661_273(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 76 4e-13
CP000248_145(CP000248|pid:none) Novosphingobium aromaticivorans ... 76 4e-13
CP000112_1457(CP000112|pid:none) Desulfovibrio desulfuricans G20... 75 7e-13
AE002152_3(AE002152|pid:none) Ureaplasma parvum serovar 3 str. A... 75 9e-13
CR380953_352(CR380953|pid:none) Candida glabrata strain CBS138 c... 75 9e-13
CP000830_823(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 75 1e-12
CR628337_1616(CR628337|pid:none) Legionella pneumophila str. Len... 75 1e-12
AM889285_2974(AM889285|pid:none) Gluconacetobacter diazotrophicu... 75 1e-12
CP000577_246(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 74 2e-12
CP000031_2865(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 74 3e-12
CP000479_4131(CP000479|pid:none) Mycobacterium avium 104, comple... 73 5e-12
CP000474_1208(CP000474|pid:none) Arthrobacter aurescens TC1, com... 73 5e-12
CP000489_2198(CP000489|pid:none) Paracoccus denitrificans PD1222... 73 5e-12
CP001184_566(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 73 5e-12
CP001389_3373(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 72 8e-12
AM236080_202(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 72 8e-12
F97374(F97374)cytidine deaminase (AJ237978) [imported] - Agrobac... 72 1e-11
AD2592(AD2592) cytidine deaminase [imported] - Agrobacterium tum... 72 1e-11
CP000140_2034(CP000140|pid:none) Parabacteroides distasonis ATCC... 71 1e-11
CP000628_257(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 71 2e-11
CU179680_117(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 71 2e-11
AE000516_3536(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 70 2e-11
CP000750_3916(CP000750|pid:none) Kineococcus radiotolerans SRS30... 70 2e-11
CP001191_4133(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 70 2e-11
CP000685_1548(CP000685|pid:none) Flavobacterium johnsoniae UW101... 70 4e-11
CP000395_625(CP000395|pid:none) Borrelia afzelii PKo, complete g... 70 4e-11
AL591688_128(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 69 5e-11
CP000013_608(CP000013|pid:none) Borrelia garinii PBi, complete g... 69 5e-11
A70177(A70177) cytidine deaminase (cdd) homolog - Lyme disease s... 69 5e-11
CP000133_183(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 69 7e-11
AP006618_957(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 69 9e-11
CU458896_3643(CU458896|pid:none) Mycobacterium abscessus chromos... 69 9e-11
AE017263_143(AE017263|pid:none) Mesoplasma florum L1 complete ge... 68 1e-10
CP001016_3001(CP001016|pid:none) Beijerinckia indica subsp. indi... 68 1e-10
CP001601_1877(CP001601|pid:none) Corynebacterium aurimucosum ATC... 68 2e-10
A87181(A87181) cytidine deaminase [imported] - Mycobacterium lep... 67 2e-10
CP000048_594(CP000048|pid:none) Borrelia hermsii DAH, complete g... 67 2e-10
(P75051) RecName: Full=Cytidine deaminase; Short=CDA; ... 67 2e-10
AE015924_26(AE015924|pid:none) Porphyromonas gingivalis W83, com... 67 2e-10
CP000910_318(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 67 3e-10
CP000264_2987(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 67 3e-10
AE017283_1694(AE017283|pid:none) Propionibacterium acnes KPA1712... 66 4e-10
CP000850_738(CP000850|pid:none) Salinispora arenicola CNS-205, c... 65 7e-10
CP000667_803(CP000667|pid:none) Salinispora tropica CNB-440, com... 65 7e-10
AE017221_383(AE017221|pid:none) Thermus thermophilus HB27, compl... 65 1e-09
CU207366_2853(CU207366|pid:none) Gramella forsetii KT0803 comple... 65 1e-09
BA000012_2428(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 64 2e-09
CR626927_1355(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 64 2e-09
BA000030_3372(BA000030|pid:none) Streptomyces avermitilis MA-468... 64 2e-09
CP000480_1626(CP000480|pid:none) Mycobacterium smegmatis str. MC... 64 2e-09
AE017245_380(AE017245|pid:none) Mycoplasma synoviae 53, complete... 64 3e-09
CP000049_593(CP000049|pid:none) Borrelia turicatae 91E135, compl... 64 3e-09
AM494954_34(AM494954|pid:none) Leishmania braziliensis chromosom... 64 3e-09
CP000976_593(CP000976|pid:none) Borrelia duttonii Ly, complete g... 64 3e-09
CP000511_1568(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 64 3e-09
CP000656_4815(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 63 4e-09
AM711867_997(AM711867|pid:none) Clavibacter michiganensis subsp.... 63 4e-09
AL445564_98(AL445564|pid:none) Mycoplasma pulmonis (strain UAB C... 63 5e-09
CP000384_1221(CP000384|pid:none) Mycobacterium sp. MCS, complete... 62 6e-09
CP001340_3105(CP001340|pid:none) Caulobacter crescentus NA1000, ... 62 8e-09
A97221(A97221) cytidine deaminase family enzyme [imported] - Clo... 62 8e-09
CP000813_1709(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 62 1e-08
CP000854_1191(CP000854|pid:none) Mycobacterium marinum M, comple... 61 1e-08
AM502235_39(AM502235|pid:none) Leishmania infantum chromosome 17. 61 1e-08
CP000325_1132(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 61 1e-08
CT005256_42(CT005256|pid:none) Leishmania major strain Friedlin,... 61 2e-08
CP000613_2214(CP000613|pid:none) Rhodospirillum centenum SW, com... 61 2e-08
CP000159_1369(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 60 2e-08
AP011115_6308(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 60 3e-08
CP000431_6190(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 60 3e-08
CP000249_673(CP000249|pid:none) Frankia sp. CcI3, complete genome. 57 2e-07
CP001047_246(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 57 2e-07
EU908847_1(EU908847|pid:none) Expression vector pDM360, complete... 57 3e-07
AB041927_1(AB041927|pid:none) Retroviral vector pCXbsr DNA, comp... 57 3e-07
(P33967) RecName: Full=Blasticidin-S deaminase; EC=3.5.... 57 3e-07
CP000227_2590(CP000227|pid:none) Bacillus cereus Q1, complete ge... 57 3e-07
AB277269_1(AB277269|pid:none) Cloning vector piMARK DNA, complet... 57 3e-07
CP001177_2729(CP001177|pid:none) Bacillus cereus AH187, complete... 55 8e-07
AL079344_12(AL079344|pid:none) Arabidopsis thaliana DNA chromoso... 55 1e-06
AF080676_4(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 55 1e-06
AF121877_4(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 55 1e-06
FB898813_1(FB898813|pid:none) Sequence 118086 from Patent WO2008... 55 1e-06
(P44325) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06
(Q87Q52) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06
AE017308_347(AE017308|pid:none) Mycoplasma mobile 163K complete ... 54 3e-06
(A5UBV9) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 54 3e-06
CP001321_1365(CP001321|pid:none) Haemophilus parasuis SH0165, co... 53 4e-06
(Q2NUD2) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 53 4e-06
AY085453_1(AY085453|pid:none) Arabidopsis thaliana clone 152285 ... 51 1e-05
CP000463_4726(CP000463|pid:none) Rhodopseudomonas palustris BisA... 51 1e-05
CP001600_1217(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 51 1e-05
AF134485_1(AF134485|pid:none) Arabidopsis thaliana cytidine deam... 51 1e-05
AC005917_16(AC005917|pid:none) Arabidopsis thaliana chromosome 2... 51 1e-05
CP000301_4747(CP000301|pid:none) Rhodopseudomonas palustris BisB... 51 2e-05
CR954205_40(CR954205|pid:none) Ostreococcus tauri strain OTTH059... 50 2e-05
CP000250_4246(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 50 2e-05
(Q65RG8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 50 3e-05
EF085825_1(EF085825|pid:none) Picea sitchensis clone WS0293_F20 ... 50 4e-05
BA000037_1962(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 50 4e-05
AE016795_2209(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 50 4e-05
CP000962_3355(CP000962|pid:none) Clostridium botulinum A3 str. L... 50 4e-05
(Q7MK48) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 50 4e-05
CP000585_41(CP000585|pid:none) Ostreococcus lucimarinus CCE9901 ... 50 4e-05
CP000866_1467(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 49 9e-05
FB898781_1(FB898781|pid:none) Sequence 118054 from Patent WO2008... 49 9e-05
CP000283_4147(CP000283|pid:none) Rhodopseudomonas palustris BisB... 48 1e-04
BX572596_153(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 48 2e-04
CP000817_3550(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 48 2e-04
AP006627_475(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 47 2e-04
(A5F1V7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 47 2e-04
(Q9KSM5) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 47 2e-04
AF080676_3(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 47 3e-04
DQ056661_1(DQ056661|pid:none) Arabidopsis thaliana putative cyti... 47 3e-04
CP000939_3372(CP000939|pid:none) Clostridium botulinum B1 str. O... 47 3e-04
FB898893_1(FB898893|pid:none) Sequence 118166 from Patent WO2008... 47 3e-04
AL079344_11(AL079344|pid:none) Arabidopsis thaliana DNA chromoso... 47 3e-04
AP007159_700(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 47 4e-04
CP001581_3587(CP001581|pid:none) Clostridium botulinum A2 str. K... 47 4e-04
AF080676_6(AF080676|pid:none) Arabidopsis thaliana cytidine deam... 47 4e-04
AF121877_6(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 46 5e-04
(A3N1Z1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 46 5e-04
(Q6LRI0) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 46 6e-04
AK243606_1(AK243606|pid:none) Oryza sativa Japonica Group cDNA, ... 45 8e-04
(A8FWK2) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 45 8e-04
(A8H5H1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 45 8e-04
AM412317_251(AM412317|pid:none) Clostridium botulinum A str. ATC... 45 0.001
CP001083_251(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 45 0.001
AY634312_1(AY634312|pid:none) Homo sapiens small cytidine deamin... 45 0.001
AF121877_5(AF121877|pid:none) Arabidopsis thaliana cytidine deam... 44 0.002
FB898771_1(FB898771|pid:none) Sequence 118044 from Patent WO2008... 44 0.003
(B0TQV3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003
(A4TKN7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003
(B8CR83) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 44 0.003
AF095644_1(AF095644|pid:none) Homo sapiens cytidine deaminase (C... 43 0.004
AM286415_2650(AM286415|pid:none) Yersinia enterocolitica subsp. ... 43 0.004
(Q9CP11) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 43 0.005
(Q3IBX5) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 43 0.005
(B7NMA8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.007
AB364160_2(AB364160|pid:none) S. pombe expression vector pHIS3B ... 42 0.012
CU234118_1080(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 42 0.012
(P0C2P1) RecName: Full=Blasticidin-S deaminase; EC=3.5.... 42 0.012
(B7LVA3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.012
DQ813653_2(DQ813653|pid:none) Cloning vector pLN-ENR-GFP, comple... 42 0.012
X63144_1(X63144|pid:none) E.coli cdd gene for cytidine deaminase. 42 0.012
CP000494_6489(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 42 0.012
(B1IYC6) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 42 0.012
(B5XP65) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015
(Q083S7) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015
CP000961_2031(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 41 0.015
(A8GC32) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.015
(A9N6L3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020
(Q8Z5A8) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020
AL939124_185(AL939124|pid:none) Streptomyces coelicolor A3(2) co... 41 0.020
(Q5PE68) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020
CP001138_2175(CP001138|pid:none) Salmonella enterica subsp. ente... 41 0.020
(A6TBN1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 41 0.020
(Q32EM3) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 40 0.026
(B5YW75) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 40 0.026
AM920435_1338(AM920435|pid:none) Penicillium chrysogenum Wiscons... 40 0.044
CP000252_480(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 40 0.044
AM849034_213(AM849034|pid:none) Clavibacter michiganensis subsp.... 39 0.057
(A4WCI1) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 39 0.075
(A3D392) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 38 0.13
CP001015_1937(CP001015|pid:none) Streptococcus pneumoniae G54, c... 38 0.13
(Q6D3B4) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 38 0.17
EU244406_1(EU244406|pid:none) Haliotis diversicolor clone HDr4CJ... 37 0.22
CP000414_1064(CP000414|pid:none) Leuconostoc mesenteroides subsp... 37 0.22
CP001033_2035(CP001033|pid:none) Streptococcus pneumoniae CGSP14... 37 0.28
CP001323_733(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 37 0.28
CU633901_61(CU633901|pid:none) Podospora anserina genomic DNA ch... 37 0.28
(Q0HTT9) RecName: Full=Cytidine deaminase; EC=3.5.4.5; ... 37 0.28
CP000023_1231(CP000023|pid:none) Streptococcus thermophilus LMG ... 37 0.37
AE007317_1877(AE007317|pid:none) Streptococcus pneumoniae R6, co... 36 0.63
AE005672_1965(AE005672|pid:none) Streptococcus pneumoniae TIGR4,... 36 0.63
DQ787200_6(DQ787200|pid:none) Cylindrospermopsis raciborskii T3 ... 34 1.8
AE017333_2142(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 34 2.4
CP000750_2378(CP000750|pid:none) Kineococcus radiotolerans SRS30... 33 3.1
DQ787201_1(DQ787201|pid:none) Anabaena circinalis AWQC131C toxin... 33 3.1
DQ364229_9(DQ364229|pid:none) Xenos vesparum mitochondrion, part... 33 5.4
AM286745_9(AM286745|pid:none) Xenos vesparum partial mitochondri... 33 5.4
CP001078_1075(CP001078|pid:none) Clostridium botulinum E3 str. A... 32 7.0
CT573213_1951(CT573213|pid:none) Frankia alni str. ACN14A chromo... 32 7.0
>FJ426114_1(FJ426114|pid:none) Epinephelus coioides cytidine
deaminase mRNA, partial cds.
Length = 176
Score = 146 bits (369), Expect = 3e-34
Identities = 74/136 (54%), Positives = 98/136 (72%), Gaps = 1/136 (0%)
Frame = +2
Query: 53 MNQEELEKCIDAAQNSQQYAHCPYSHFRIGAALLTSCGKIFTGVNVENSSYGLTICAERT 232
++QE +++ I +Q ++Q A+CPYS FR+GAALLT +FTG NVEN+ Y L +CAERT
Sbjct: 32 LSQETVKRLILQSQKAKQQAYCPYSKFRVGAALLTLDNCVFTGCNVENACYNLGLCAERT 91
Query: 233 AYTKAVSEGYKSFKGIVVASDLKDRFITPCGACRQFGVEFG-DFEVVCVKPDRSTFKSST 409
A +KAVSEGY+SFK I +ASDL D+FI+PCG CRQF EFG +++V KPD S K +
Sbjct: 92 AISKAVSEGYRSFKAIAIASDLNDQFISPCGGCRQFIREFGSNWDVYLSKPDGSYLKMTV 151
Query: 410 HKLLPGLFSQEDLIAK 457
+LLP F E+L K
Sbjct: 152 DELLPVSFGPEELSMK 167
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 816,465,385
Number of extensions: 15868248
Number of successful extensions: 45128
Number of sequences better than 10.0: 338
Number of HSP's gapped: 44719
Number of HSP's successfully gapped: 375
Length of query: 171
Length of database: 1,040,966,779
Length adjustment: 119
Effective length of query: 52
Effective length of database: 659,656,864
Effective search space: 34302156928
Effective search space used: 34302156928
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
|