| Homology vs DNA |
 Query= Contig-U11322-1 (Contig-U11322-1Q) /CSM_Contig/Contig-U11322-1Q.Seq.d (1529 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ437346) Dictyostelium discoideum cDNA clone:ddv33p23, 3' ... 1522 0.0 1 (BJ446349) Dictyostelium discoideum cDNA clone:ddv62n11, 3' ... 1455 0.0 1 (BJ445997) Dictyostelium discoideum cDNA clone:ddv61g07, 3' ... 1318 0.0 1 (BJ439826) Dictyostelium discoideum cDNA clone:ddv41a22, 3' ... 1183 0.0 2 (BJ350852) Dictyostelium discoideum cDNA clone:dda41a08, 3' ... 1108 0.0 3 (BJ437347) Dictyostelium discoideum cDNA clone:ddv33p24, 3' ... 1029 0.0 1 (BJ331055) Dictyostelium discoideum cDNA clone:dda33p16, 5' ... 989 0.0 3 (BJ336701) Dictyostelium discoideum cDNA clone:dda54h19, 5' ... 981 0.0 2 (BJ333030) Dictyostelium discoideum cDNA clone:dda41a08, 5' ... 908 0.0 4 (FE709727) Pv018D_M13F_C03.ab1 Phaseolus vulgaris cv Early g... 66 1e-15 4 (DY893367) CeleSEQ12687 Cunninghamella elegans pBluescript (... 60 7e-13 4 (DY893327) CeleSEQ12634 Cunninghamella elegans pBluescript (... 60 8e-13 4 (EY089176) CAZI18761.fwd CAZI Artemisia annua normalized lea... 50 5e-10 4 (BG790941) sae71h07.y1 Gm-c1064 Glycine max cDNA clone GENOM... 46 2e-09 4 (ED723179) GM_WBb0076P09.f GM_WBb Glycine max genomic clone ... 46 2e-09 4 (CO982162) GM89003B2F05.r2 Gm-r1089 Glycine max cDNA clone G... 46 3e-09 4 (FK009552) GLQA462TF JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 46 5e-09 4 (CO978659) GM89001A2A12.r1 Gm-r1089 Glycine max cDNA clone G... 46 6e-09 4 (CO984415) GM89013B1A07.r2 Gm-r1089 Glycine max cDNA clone G... 46 6e-09 4 (FK009553) GLQA462TR JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 46 6e-08 4 (EY092579) CAZI20798.fwd CAZI Artemisia annua normalized lea... 50 1e-07 3 (CN914857) 030115ABNB002110HT (ABNB) Braeburn cultured fruit... 44 1e-07 4 (FK202144) XABT212258.b1 Gateway compatible cien cDNA librar... 44 5e-07 3 (FE237181) CAPG4252.rev CAPG Naegleria gruberi amoeba stage ... 48 7e-07 2 (FF807675) XABT98198.fwd Gateway compatible cien cDNA librar... 44 1e-06 3 (EJ441275) 1093015305445 Global-Ocean-Sampling_GS-28-01-01-1... 46 1e-06 2 (CN859148) 000728AAAA008956HT (AAAA) Royal Gala 59 DAFB frui... 44 4e-06 3 (BM143511) saj45b04.y1 Gm-c1072 Glycine max cDNA clone SOYBE... 44 4e-06 3 (ER616150) 1093017254661 Global-Ocean-Sampling_GS-36-01-01-2... 46 5e-06 2 (CN860052) 000729AAAA010402HT (AAAA) Royal Gala 59 DAFB frui... 44 5e-06 3 (FE254651) CAPH5160.rev CAPH Naegleria gruberi amoeba stage ... 48 9e-06 2 (FE254652) CAPH5160.fwd CAPH Naegleria gruberi amoeba stage ... 48 9e-06 2 (EJ353294) 1092963609782 Global-Ocean-Sampling_GS-28-01-01-1... 46 9e-06 2 (ER480121) 1093015258049 Global-Ocean-Sampling_GS-35-01-01-1... 46 1e-05 2 (BI073697) kt33g08.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 38 1e-05 4 (FF545331) MOPDR58TF MOP Vigna unguiculata cDNA 5', mRNA seq... 54 1e-04 2 (CA152023) SCJFRZ2015A03.g RZ2 Saccharum officinarum cDNA cl... 52 1e-04 2 (FG857525) UCRVU05_CCNN21306_g1 Cowpea IT84S-2049 Mixed Tiss... 54 1e-04 2 (FF392108) MOOCU64TF MOO Vigna unguiculata cDNA 5', mRNA seq... 54 1e-04 2 (FC816553) Sr_pAMT7_06h05_T7 S. ratti mixed stage pAMP Stron... 38 1e-04 4 (FF300421) 279337723 Pea aphid whole body normalized full le... 52 5e-04 2 (DT338914) JBW091D03.b_025.abi Pineapple week 5-10 nematode-... 52 5e-04 2 (CG821149) SOYEG61TH LargeInsertSoybeanGenLib Glycine max ge... 46 0.002 2 (CL564003) OB__Ba0027D04.f OB__Ba Oryza brachyantha genomic ... 48 0.002 2 (CL581179) OB__Ba0043J20.r OB__Ba Oryza brachyantha genomic ... 48 0.002 2 (EJ009402) 1095403589311 Global-Ocean-Sampling_GS-26-01-01-1... 44 0.002 2 (CL538003) OB__Ba0047A11.f OB__Ba Oryza brachyantha genomic ... 48 0.002 2 (CL568714) OB__Ba0043D19.f OB__Ba Oryza brachyantha genomic ... 48 0.002 2 (EJ409172) 1093012122644 Global-Ocean-Sampling_GS-28-01-01-1... 44 0.002 2 (CV185893) taj16b10.y1 Hydra EST UCI 5 ALP Hydra magnipapill... 40 0.003 3 (CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.003 19 (CV185622) taj16b10.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 40 0.003 3 (AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 40 0.004 14 (CK260557) EST706635 potato abiotic stress cDNA library Sola... 56 0.004 1 (FG161985) AGN_RNC017xi08r1.ab1 AGN_RNC Nicotiana tabacum cD... 56 0.004 1 (FG151833) AGN_RNC109xi14r1.ab1 AGN_RNC Nicotiana tabacum cD... 56 0.004 1 (EY092578) CAZI20798.rev CAZI Artemisia annua normalized lea... 50 0.006 2 (EY089175) CAZI18761.rev CAZI Artemisia annua normalized lea... 50 0.006 2 (EY504007) CBBP7250.fwd CBBP Hirudo medicinalis hermaphrodit... 46 0.006 2 (EJ828315) 1093017570040 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.007 2 (AL428456) clone BA0AB025H06 of library BA0AB from strain CL... 54 0.007 2 (EJ891125) 1093018442868 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.007 2 (AM433445) Vitis vinifera, whole genome shotgun sequence, co... 34 0.010 7 (CR382123) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 54 0.016 1 (EJ180718) 1092344121170 Global-Ocean-Sampling_GS-27-01-01-1... 54 0.016 1 (FF542666) MOPC688TF MOP Vigna unguiculata cDNA 5', mRNA seq... 54 0.016 1 (CJ675301) Triticum aestivum cDNA clone whms1k13 5', Y.Ogiha... 40 0.017 3 (AV821184) Arabidopsis thaliana cDNA clone:RAFL02-08-J13, 5'... 50 0.019 2 (BT004510) Arabidopsis thaliana At5g37830/K22F20_70 gene, co... 50 0.027 3 (CT875520) Phaeodactylum tricornutum 5-PRIME EST from clone ... 46 0.030 2 (CT948554) Phaeodactylum tricornutum 5-PRIME EST from clone ... 46 0.031 2 (AY102096) Arabidopsis thaliana AT5g37830/K22F20_70 mRNA, co... 50 0.032 3 (CT917902) Phaeodactylum tricornutum 5-PRIME EST from clone ... 46 0.033 2 (EJ892027) 1093018448027 Global-Ocean-Sampling_GS-30-02-01-1... 38 0.050 2 (X59371) Yeast URA1 gene for dihydroorotic acid dehydrogenase. 38 0.058 3 (M83295) Saccharomyces cerevisiae dihydroorotic acid dehydro... 38 0.058 3 (BA000021) Wigglesworthia glossinidia endosymbiont of Glossi... 38 0.061 18 (CU329670) Schizosaccharomyces pombe chromosome I. 52 0.064 1 (AC130777) Rattus norvegicus clone CH230-24M8, *** SEQUENCIN... 52 0.064 1 (CU457457) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 52 0.064 1 (CN582087) Mdfw2034o24.y1 Mdfw Malus x domestica cDNA clone ... 44 0.064 2 (AI938008) sc06h10.y1 Gm-c1012 Glycine max cDNA clone GENOME... 40 0.068 2 (AK228904) Arabidopsis thaliana mRNA for 5-oxoprolinase -lik... 50 0.086 2 (CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 40 0.091 21 (CT943882) Phaeodactylum tricornutum 5-PRIME EST from clone ... 46 0.10 2 (CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 38 0.13 14 (Z28215) S.cerevisiae chromosome XI reading frame ORF YKL215c. 38 0.15 3 (AC144517) Medicago truncatula clone mth2-13k17, complete se... 42 0.15 5 (AL590225) Human DNA sequence from clone RP11-358H7 on chrom... 40 0.16 2 (CJ773547) Triticum aestivum cDNA clone:whatl10b14, 5' end. 40 0.18 2 (FC811080) Sr_pASP6_06h05_SP6 S. ratti mixed stage pAMP Stro... 38 0.19 2 (BX005016) Zebrafish DNA sequence from clone DKEY-104E13 in ... 36 0.22 11 (AB016873) Arabidopsis thaliana genomic DNA, chromosome 5, T... 50 0.25 1 (EL602230) He_pwd_0223F08_M13R Heliconius erato pooled wing ... 50 0.25 1 (DB919919) Idiosepius paradoxus cDNA, clone:Ip_aB_036_J20, 5... 50 0.25 1 (AJ497287) Medicago truncatula EST, clone mt--abc955107d04. 42 0.29 2 (BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 34 0.29 21 (CW191860) 104_614_11178721_116_36943_013 Sorghum methylatio... 40 0.31 2 (AC157890) Medicago truncatula chromosome 7 clone mte1-17h9,... 36 0.32 6 (AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 32 0.33 16
>(BJ437346) Dictyostelium discoideum cDNA clone:ddv33p23, 3' end, single read. Length = 785
Score = 1522 bits (768), Expect = 0.0 Identities = 771/772 (99%) Strand = Plus / Minus
Query: 600 tggatgttgttcatgcctatatgtatcatattcaaaagaatgctgaattagctgttagag 659 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 785 tggatgttgttcatgcctatatgtatcatattcaaaagaatgctgaattagctgttagag 726
Query: 660 atatgttatatgatatttcaatttcaaataatttaaaaccactcgatacacttatttcca 719 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 725 atatgttatatgatatttcaatttcaaataatttaaaaccactcgatacacttatttcca 666
Query: 720 ccgattatatggatgatggttcaaagattgaattaaagttaaccattgatcgtgagaaaa 779 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 665 ccgattatatggatgatggttcaaagattgaattaaagttaaccattgatcgtgagaaaa 606
Query: 780 agtctgcaattttcgattggagtggatcaggtgttgaagtatatggcaatacaaatgcac 839 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 605 agtctgcaattttcgattggagtggatcaggtgttgaagtatatggcaatacaaatgcac 546
Query: 840 caacgtcaattacactatctgctaccatctatagtctcagagcaatggtaaagagtgaaa 899 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 545 caacgtcaattacactatctgctaccatctatagtctcagagcaatggtaaagagtgaaa 486
Query: 900 taccattaaatcaaggttgtttagctccaattttaaccgtaatcccaccaggctcaattt 959 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 485 taccattaaatcaaggttgtttagctccaattttaaccgtaatcccaccaggctcaattt 426
Query: 960 taaatccatcatttgattctgctgtcgtaggaggtaatgttttaacaagtcaacgtttaa 1019 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 425 taaatccatcatttgattctgctgtcgtaggaggtaatgttttaacaagtcaacgtttaa 366
Query: 1020 ccgatgttattttatctgcatttggtgcttgtgccaatagtcaaggctgtatgaataatt 1079 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 365 ccgatgttattttatctgcatttggtgcttgtgccaatagtcaaggctgtatgaataatt 306
Query: 1080 taacttttggtgatgaaacattgggttactatgaaactattgctggtggtacaggtgctg 1139 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 305 taacttttggtgatgaaacattgggttactatgaaactattgctggtggtacaggtgctg 246
Query: 1140 gtccaaattttaatggtttcactgctgttcaatctcatatgaccaatacaagaatcactg 1199 |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| Sbjct: 245 gtccaaattttaatggtttcactgctgttcaatctcatatgaccaatacaggaatcactg 186
Query: 1200 atgttgaaattatggaaaaacgttatccagtaatcgttaaagaatttagtgttagatatg 1259 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 185 atgttgaaattatggaaaaacgttatccagtaatcgttaaagaatttagtgttagatatg 126
Query: 1260 gttcaggtggtgatggtaaatttaaaggtggtgatggtgtagtcagagaaattcaattct 1319 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 125 gttcaggtggtgatggtaaatttaaaggtggtgatggtgtagtcagagaaattcaattct 66
Query: 1320 taaaaaatttcacagtaagtatcctatcagaacgtcgttcattacaaccacg 1371 |||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 65 taaaaaatttcacagtaagtatcctatcagaacgtcgttcattacaaccacg 14
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,936,145,792 Number of extensions: 123326127 Number of successful extensions: 10371220 Number of sequences better than 10.0: 294 Length of query: 1529 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1505 Effective length of database: 97,308,875,965 Effective search space: 146449858327325 Effective search space used: 146449858327325 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
| Homology vs Protein |
 Query= Contig-U11322-1 (Contig-U11322-1Q) /CSM_Contig/Contig-U11322-1Q.Seq.d (1529 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54NW6) RecName: Full=5-oxoprolinase; EC=3.5.2.9; AltN... 545 e-153 CP000586_203(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 327 7e-88 BC025120_1(BC025120|pid:none) Mus musculus 5-oxoprolinase (ATP-h... 325 3e-87 (O14841) RecName: Full=5-oxoprolinase; EC=3.5.2.9; AltN... 325 3e-87 AK164524_1(AK164524|pid:none) Mus musculus 13 days embryo heart ... 325 3e-87 (P97608) RecName: Full=5-oxoprolinase; EC=3.5.2.9; AltN... 323 8e-87 BC125692_1(BC125692|pid:none) Xenopus tropicalis hypothetical pr... 320 7e-86 CP001575_8(CP001575|pid:none) Micromonas sp. RCC299 chromosome 8... 314 5e-84 AC144517_12(AC144517|pid:none) Medicago truncatula clone mth2-13... 311 3e-83 AK120106_1(AK120106|pid:none) Oryza sativa Japonica Group cDNA c... 307 6e-82 AB016873_10(AB016873|pid:none) Arabidopsis thaliana genomic DNA,... 306 1e-81 AM920428_551(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 304 5e-81 AC025715_10(AC025715|pid:none) Caenorhabditis elegans cosmid Y38... 296 1e-78 AC025715_11(AC025715|pid:none) Caenorhabditis elegans cosmid Y38... 296 1e-78 AL096750_1(AL096750|pid:none) Homo sapiens mRNA; cDNA DKFZp434H2... 293 9e-78 AM920437_29(AM920437|pid:none) Penicillium chrysogenum Wisconsin... 292 2e-77 AJ439398_7(AJ439398|pid:none) Anopheles gambiae BAC clone 22J3. 290 7e-77 AM920435_1212(AM920435|pid:none) Penicillium chrysogenum Wiscons... 288 5e-76 (Q10093) RecName: Full=Uncharacterized protein C11D3.14c; &CU32... 287 6e-76 BX294012_6(BX294012|pid:none) Neurospora crassa DNA linkage grou... 283 1e-74 AE017343_264(AE017343|pid:none) Cryptococcus neoformans var. neo... 272 2e-71 CR380957_3(CR380957|pid:none) Candida glabrata strain CBS138 chr... 271 5e-71 CR382131_101(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 268 3e-70 CU928169_16(CU928169|pid:none) Kluyveromyces thermotolerans stra... 267 7e-70 AM270158_34(AM270158|pid:none) Aspergillus niger contig An08c003... 266 2e-69 (Q10094) RecName: Full=Uncharacterized protein C11D3.15; &CU329... 265 3e-69 CR954206_231(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 261 5e-68 CT005257_104(CT005257|pid:none) Leishmania major strain Friedlin... 258 3e-67 CU928179_8(CU928179|pid:none) Zygosaccharomyces rouxii strain CB... 256 2e-66 AE010299_2239(AE010299|pid:none) Methanosarcina acetivorans str.... 256 2e-66 FM992689_274(FM992689|pid:none) Candida dubliniensis CD36 chromo... 256 2e-66 AM270272_51(AM270272|pid:none) Aspergillus niger contig An12c016... 251 4e-65 CP000099_3229(CP000099|pid:none) Methanosarcina barkeri str. Fus... 248 3e-64 (P28273) RecName: Full=Uncharacterized protein YKL215C; &S38058... 247 7e-64 CP000774_2393(CP000774|pid:none) Parvibaculum lavamentivorans DS... 247 7e-64 CP000806_1668(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 239 3e-61 AM920437_1668(AM920437|pid:none) Penicillium chrysogenum Wiscons... 238 6e-61 AP009179_861(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic D... 237 7e-61 CP000157_1852(CP000157|pid:none) Erythrobacter litoralis HTCC259... 237 1e-60 CP000828_3734(CP000828|pid:none) Acaryochloris marina MBIC11017,... 236 2e-60 M83295_2(M83295|pid:none) Saccharomyces cerevisiae dihydroorotic... 235 4e-60 CP000951_2472(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 234 5e-60 CP000127_348(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 233 1e-59 AP009178_1772(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 233 1e-59 CP000300_2018(CP000300|pid:none) Methanococcoides burtonii DSM 6... 232 3e-59 CP001037_5980(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 231 7e-59 CP000927_3614(CP000927|pid:none) Caulobacter sp. K31, complete g... 231 7e-59 CP000117_2237(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 230 9e-59 CP001291_3451(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 229 3e-58 AE005673_2352(AE005673|pid:none) Caulobacter crescentus CB15, co... 228 4e-58 CP001340_2452(CP001340|pid:none) Caulobacter crescentus NA1000, ... 228 4e-58 AM408590_304(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 227 8e-58 BA000022_2760(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 226 2e-57 CP000613_610(CP000613|pid:none) Rhodospirillum centenum SW, comp... 226 2e-57 CP000264_2566(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 223 1e-56 CP000272_4(CP000272|pid:none) Burkholderia xenovorans LB400 chro... 223 1e-56 CP000496_403(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 223 1e-56 AE017224_512(AE017224|pid:none) Brucella abortus biovar 1 str. 9... 222 3e-56 CP000390_2008(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 221 4e-56 CP000912_611(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 219 2e-55 AE008918_603(AE008918|pid:none) Brucella melitensis 16M chromoso... 219 2e-55 AP009552_2813(AP009552|pid:none) Microcystis aeruginosa NIES-843... 219 2e-55 CP000542_2850(CP000542|pid:none) Verminephrobacter eiseniae EF01... 219 2e-55 CP000709_561(CP000709|pid:none) Brucella ovis ATCC 25840 chromos... 219 3e-55 AM236080_2450(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 217 8e-55 CP000544_721(CP000544|pid:none) Halorhodospira halophila SL1, co... 216 1e-54 BA000039_2170(BA000039|pid:none) Thermosynechococcus elongatus B... 216 1e-54 AM902716_2251(AM902716|pid:none) Bordetella petrii strain DSM 12... 215 4e-54 CP000137_300(CP000137|pid:none) Rhizobium etli CFN 42 plasmid p4... 215 4e-54 AE014292_656(AE014292|pid:none) Brucella suis 1330 chromosome II... 215 4e-54 AP009493_6121(AP009493|pid:none) Streptomyces griseus subsp. gri... 214 5e-54 CT978603_1836(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 214 7e-54 CP000615_710(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 214 7e-54 AP007174_361(AP007174|pid:none) Aspergillus oryzae RIB40 genomic... 214 9e-54 CP001193_183(CP001193|pid:none) Rhizobium leguminosarum bv. trif... 214 9e-54 AP008231_1715(AP008231|pid:none) Synechococcus elongatus PCC 630... 213 1e-53 AP009384_168(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 213 2e-53 CP000555_2959(CP000555|pid:none) Methylibium petroleiphilum PM1,... 213 2e-53 CP000739_524(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 212 3e-53 AP009386_198(AP009386|pid:none) Burkholderia multivorans ATCC 17... 212 3e-53 AM747721_584(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 212 3e-53 BX640446_32(BX640446|pid:none) Bordetella bronchiseptica strain ... 212 3e-53 BX640432_93(BX640432|pid:none) Bordetella parapertussis strain 1... 211 4e-53 CP000959_777(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c... 211 6e-53 AL591985_26(AL591985|pid:none) Sinorhizobium meliloti 1021 plasm... 210 1e-52 CP000459_378(CP000459|pid:none) Burkholderia cenocepacia HI2424 ... 210 1e-52 CP000512_3237(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 209 2e-52 CP000554_1997(CP000554|pid:none) Prochlorococcus marinus str. MI... 209 3e-52 CP000152_2568(CP000152|pid:none) Burkholderia sp. 383 chromosome... 209 3e-52 CP000884_4958(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 207 6e-52 BA000012_1234(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 207 8e-52 AM746676_4084(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 207 8e-52 CP001101_1316(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 206 1e-51 CP000388_3781(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 206 2e-51 CP000316_1750(CP000316|pid:none) Polaromonas sp. JS666, complete... 204 5e-51 CP001392_1355(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 204 7e-51 CP000539_2385(CP000539|pid:none) Acidovorax sp. JS42, complete g... 204 7e-51 CP000110_1566(CP000110|pid:none) Synechococcus sp. CC9605, compl... 191 6e-47 CP000097_1348(CP000097|pid:none) Synechococcus sp. CC9902, compl... 189 2e-46 CP000471_1493(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 187 7e-46 AE000657_1331(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 187 1e-45 CP001230_1441(CP001230|pid:none) Persephonella marina EX-H1, com... 180 1e-43 BX294147_33(BX294147|pid:none) Rhodopirellula baltica SH 1 compl... 172 4e-41 AK228904_1(AK228904|pid:none) Arabidopsis thaliana mRNA for 5-ox... 171 7e-41 CP000686_2639(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 166 3e-39 CP001100_1376(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 164 1e-38 CP000804_1917(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 161 7e-38 AF024673_1(AF024673|pid:none) Homo sapiens 5-oxo-L-prolinase (OP... 160 1e-37 AM286690_720(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 160 1e-37 CP001339_2435(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 159 3e-37 CP000360_3916(CP000360|pid:none) Acidobacteria bacterium Ellin34... 157 7e-37 BA000045_1226(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 157 1e-36 CP000240_935(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 153 2e-35 CP000453_1097(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 152 4e-35 AK158391_1(AK158391|pid:none) Mus musculus adult inner ear cDNA,... 151 5e-35 AF217994_1(AF217994|pid:none) Homo sapiens clone PP1746 unknown ... 148 6e-34 AM180088_1305(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 147 1e-33 CP001399_2381(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 145 3e-33 AE017345_535(AE017345|pid:none) Cryptococcus neoformans var. neo... 145 4e-33 AE017343_266(AE017343|pid:none) Cryptococcus neoformans var. neo... 145 4e-33 CP001403_936(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 144 7e-33 CP001402_2377(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 144 9e-33 CP001404_1772(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 143 2e-32 AE006641_1846(AE006641|pid:none) Sulfolobus solfataricus P2, com... 142 3e-32 AE006641_2690(AE006641|pid:none) Sulfolobus solfataricus P2, com... 141 7e-32 AM270108_56(AM270108|pid:none) Aspergillus niger contig An06c002... 140 1e-31 CP000820_6063(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 140 2e-31 AE009441_1401(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 138 5e-31 AE017261_461(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 138 5e-31 BA000011_825(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 137 1e-30 AP009153_1181(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 136 2e-30 CP000159_108(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 135 5e-30 CP000682_1113(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 133 2e-29 B72486(B72486)probable hydantoinase APE2530 - Aeropyrum pernix (... 132 3e-29 CP001287_1192(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 125 4e-27 CP001014_456(CP001014|pid:none) Thermoproteus neutrophilus V24St... 119 2e-25 CP000561_418(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 119 3e-25 CP001037_5982(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 117 1e-24 AB2427(AB2427) hypothetical protein all4970 [imported] - Nostoc ... 113 2e-23 CP000816_291(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 112 4e-23 AP009552_879(AP009552|pid:none) Microcystis aeruginosa NIES-843 ... 106 2e-21 CP000636_93(CP000636|pid:none) Agrobacterium vitis S4 plasmid pA... 105 6e-21 BA000040_3327(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 98 9e-19 CP001349_3279(CP001349|pid:none) Methylobacterium nodulans ORS 2... 96 3e-18 CP000699_471(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 96 3e-18 AP009384_1796(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 88 9e-16 CP000943_5352(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 86 3e-15 CP000760_113(CP000760|pid:none) Ochrobactrum anthropi ATCC 49188... 86 3e-15 CP001195_172(CP001195|pid:none) Rhizobium leguminosarum bv. trif... 82 5e-14 CP000092_341(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 79 3e-13 CP000031_1441(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 79 3e-13 CP000143_2245(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 79 4e-13 DQ058764_57(DQ058764|pid:none) Agrobacterium tumefaciens Ti plas... 77 1e-12 CP000637_190(CP000637|pid:none) Agrobacterium vitis S4 plasmid p... 77 2e-12 CP001053_2465(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 77 2e-12 AF065242_28(AF065242|pid:none) Agrobacterium tumefaciens chrysop... 77 2e-12 CP001276_514(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 76 3e-12 CU234118_5209(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 76 4e-12 AF242881_70(AF242881|pid:none) Agrobacterium tumefaciens octopin... 75 6e-12 CP001230_1442(CP001230|pid:none) Persephonella marina EX-H1, com... 74 1e-11 DQ058764_56(DQ058764|pid:none) Agrobacterium tumefaciens Ti plas... 74 2e-11 CP001389_3360(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 74 2e-11 CP000943_1815(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 73 3e-11 CP000820_972(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 73 3e-11 CP000271_527(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 73 3e-11 BA000012_3684(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 73 3e-11 CP001077_618(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 72 7e-11 AP009384_3039(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 72 7e-11 AM260480_2416(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 71 9e-11 A70362(A70362) N-methylhydantoinase A - Aquifex aeolicus &AE000... 71 9e-11 CP000636_92(CP000636|pid:none) Agrobacterium vitis S4 plasmid pA... 71 9e-11 CP000961_3983(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 71 9e-11 AP002086_32(AP002086|pid:none) Agrobacterium rhizogenes plasmid ... 71 1e-10 CP000830_689(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 70 2e-10 CP000091_1998(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 70 2e-10 CP000975_588(CP000975|pid:none) Methylacidiphilum infernorum V4,... 70 2e-10 AY466441_17(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 69 5e-10 AY596296_146(AY596296|pid:none) Haloarcula marismortui ATCC 4304... 69 5e-10 CP000239_1701(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 69 5e-10 CP001195_171(CP001195|pid:none) Rhizobium leguminosarum bv. trif... 69 5e-10 CP000360_2035(CP000360|pid:none) Acidobacteria bacterium Ellin34... 69 6e-10 CP000386_2357(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 67 1e-09 BA000040_3621(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 67 2e-09 CP000852_1364(CP000852|pid:none) Caldivirga maquilingensis IC-16... 67 2e-09 CP001077_816(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 67 2e-09 CP000760_112(CP000760|pid:none) Ochrobactrum anthropi ATCC 49188... 66 4e-09 CP000463_3190(CP000463|pid:none) Rhodopseudomonas palustris BisA... 65 5e-09 AD3230(AD3230) hydantoin utilization protein hyuA [imported] - A... 65 5e-09 BA000012_5526(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 65 5e-09 CP000699_4110(CP000699|pid:none) Sphingomonas wittichii RW1, com... 65 7e-09 AM889285_198(AM889285|pid:none) Gluconacetobacter diazotrophicus... 65 7e-09 CP000159_172(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 65 7e-09 CP000240_2174(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 65 7e-09 CP000699_4111(CP000699|pid:none) Sphingomonas wittichii RW1, com... 65 9e-09 AM889285_197(AM889285|pid:none) Gluconacetobacter diazotrophicus... 65 9e-09 CP000390_3695(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 64 1e-08 BA000040_7180(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 64 1e-08 CP000943_5353(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 64 2e-08 CP000494_4639(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 64 2e-08 CP000271_1883(CP000271|pid:none) Burkholderia xenovorans LB400 c... 64 2e-08 CP000638_10(CP000638|pid:none) Agrobacterium vitis S4 plasmid pA... 64 2e-08 AP002086_31(AP002086|pid:none) Agrobacterium rhizogenes plasmid ... 63 2e-08 DQ294295_1(DQ294295|pid:none) Selenomonas ruminantium strain FB3... 63 3e-08 AM286690_2584(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 63 3e-08 CP000390_397(CP000390|pid:none) Mesorhizobium sp. BNC1, complete... 63 3e-08 BA000002_1643(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 62 4e-08 AM746676_2625(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 62 4e-08 H72485(H72485)probable hydantoinase APE2528 - Aeropyrum pernix (... 62 4e-08 CP000143_2246(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 62 4e-08 CP000542_1873(CP000542|pid:none) Verminephrobacter eiseniae EF01... 62 4e-08 BA000043_2894(BA000043|pid:none) Geobacillus kaustophilus HTA426... 62 4e-08 AP009153_1179(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 62 4e-08 CP001014_455(CP001014|pid:none) Thermoproteus neutrophilus V24St... 62 6e-08 CP001389_3361(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 62 6e-08 CP000686_4220(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 62 7e-08 (Q01262) RecName: Full=Hydantoin utilization protein A; AltName:... 62 7e-08 CP000637_191(CP000637|pid:none) Agrobacterium vitis S4 plasmid p... 62 7e-08 CP000009_206(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 62 7e-08 CP000629_865(CP000629|pid:none) Agrobacterium radiobacter K84 ch... 62 7e-08 AE017261_462(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 62 7e-08 CR555306_1136(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 62 7e-08 CP001403_935(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 61 9e-08 CP000454_3616(CP000454|pid:none) Arthrobacter sp. FB24, complete... 61 9e-08 (Q01263) RecName: Full=Hydantoin utilization protein B; AltName:... 61 9e-08 CP001404_1773(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 61 9e-08 CP001404_2033(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 61 9e-08 AY466441_16(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 61 1e-07 CP000634_687(CP000634|pid:none) Agrobacterium vitis S4 chromosom... 60 2e-07 AM167904_952(AM167904|pid:none) Bordetella avium 197N complete g... 60 2e-07 CP000577_2275(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 60 2e-07 CP000272_1063(CP000272|pid:none) Burkholderia xenovorans LB400 c... 60 2e-07 CP000264_3765(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 60 2e-07 BA000013_25(BA000013|pid:none) Mesorhizobium loti MAFF303099 pML... 60 2e-07 CP001399_971(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 60 2e-07 CP001150_1996(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 60 2e-07 AP009384_3040(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 60 3e-07 AM236086_407(AM236086|pid:none) Rhizobium leguminosarum bv. vici... 60 3e-07 CP000561_419(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 60 3e-07 CP000142_3311(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 59 4e-07 CP000509_75(CP000509|pid:none) Nocardioides sp. JS614, complete ... 59 4e-07 CP000271_2607(CP000271|pid:none) Burkholderia xenovorans LB400 c... 59 5e-07 CP001400_503(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 59 5e-07 CP000804_4303(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 59 6e-07 CP001349_2996(CP001349|pid:none) Methylobacterium nodulans ORS 2... 59 6e-07 CP000629_410(CP000629|pid:none) Agrobacterium radiobacter K84 ch... 59 6e-07 CP000830_688(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 59 6e-07 CP001401_517(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 58 8e-07 CP000738_3269(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 58 8e-07 CP001401_2307(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 58 1e-06 CP000612_1536(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 58 1e-06 AM746676_2624(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 58 1e-06 CP000509_1460(CP000509|pid:none) Nocardioides sp. JS614, complet... 57 1e-06 CP000637_100(CP000637|pid:none) Agrobacterium vitis S4 plasmid p... 57 1e-06 CP000390_2619(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 57 1e-06 CP001601_636(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 57 2e-06 CP000493_1557(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 57 2e-06 CP001337_2996(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 57 2e-06 CP000077_355(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 57 2e-06 CP000613_3628(CP000613|pid:none) Rhodospirillum centenum SW, com... 56 3e-06 (Q58374) RecName: Full=Uncharacterized protein MJ0964; &D64420(... 56 3e-06 AE017333_362(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 56 4e-06 CP000682_1112(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 55 5e-06 CP000804_3404(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 55 5e-06 CP000943_1857(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 55 9e-06 BX640437_314(BX640437|pid:none) Bordetella bronchiseptica strain... 55 9e-06 BX640413_71(BX640413|pid:none) Bordetella pertussis strain Toham... 55 9e-06 CP000431_3454(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 54 1e-05 CP000082_1449(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 54 1e-05 CP001399_972(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 54 1e-05 AE009439_1091(AE009439|pid:none) Methanopyrus kandleri AV19, com... 54 1e-05 CP001350_183(CP001350|pid:none) Methylobacterium nodulans ORS 20... 54 2e-05 BA000012_5525(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 53 3e-05 BA000012_3683(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 53 3e-05 CP000813_311(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 53 3e-05 CP001195_184(CP001195|pid:none) Rhizobium leguminosarum bv. trif... 53 3e-05 CP000250_4402(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 53 3e-05 CP000031_1440(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 53 3e-05 CP000804_3403(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 53 3e-05 CP000082_1451(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 53 3e-05 CP000874_297(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pNG... 52 4e-05 CP000909_2215(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 52 6e-05 CP000943_1816(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 52 6e-05 AE017333_1884(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 52 6e-05 BX640432_247(BX640432|pid:none) Bordetella parapertussis strain ... 52 6e-05 CP000634_686(CP000634|pid:none) Agrobacterium vitis S4 chromosom... 52 6e-05 BX640447_323(BX640447|pid:none) Bordetella bronchiseptica strain... 52 6e-05 CP000002_1879(CP000002|pid:none) Bacillus licheniformis ATCC 145... 52 6e-05 BX640447_324(BX640447|pid:none) Bordetella bronchiseptica strain... 52 6e-05 BA000002_882(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 52 8e-05 CP000813_312(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 52 8e-05 BX640413_72(BX640413|pid:none) Bordetella pertussis strain Toham... 52 8e-05 BX640433_186(BX640433|pid:none) Bordetella parapertussis strain ... 51 1e-04 BX640413_137(BX640413|pid:none) Bordetella pertussis strain Toha... 51 1e-04 CP000248_176(CP000248|pid:none) Novosphingobium aromaticivorans ... 51 1e-04 CS354251_4(CS354251|pid:none) Sequence 113 from Patent WO2006024... 51 1e-04 CP001404_2032(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 51 1e-04 CP001077_815(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 50 2e-04 CP000699_3622(CP000699|pid:none) Sphingomonas wittichii RW1, com... 50 2e-04 CP000511_4820(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 50 2e-04 AE006641_1522(AE006641|pid:none) Sulfolobus solfataricus P2, com... 50 2e-04 CP000490_1500(CP000490|pid:none) Paracoccus denitrificans PD1222... 50 2e-04 AP009384_1797(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 50 3e-04 BA000040_3326(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 50 3e-04 CP000433_162(CP000433|pid:none) Rhodococcus jostii RHA1 plasmid ... 50 3e-04 CP001350_184(CP001350|pid:none) Methylobacterium nodulans ORS 20... 50 3e-04 CP000629_409(CP000629|pid:none) Agrobacterium radiobacter K84 ch... 50 3e-04 CR936258_105(CR936258|pid:none) Natronomonas pharaonis DSM 2160 ... 50 3e-04 CP000463_3191(CP000463|pid:none) Rhodopseudomonas palustris BisA... 49 4e-04 CP000433_160(CP000433|pid:none) Rhodococcus jostii RHA1 plasmid ... 49 4e-04 CP000248_175(CP000248|pid:none) Novosphingobium aromaticivorans ... 49 4e-04 CP000491_456(CP000491|pid:none) Paracoccus denitrificans PD1222 ... 49 5e-04 BX640437_315(BX640437|pid:none) Bordetella bronchiseptica strain... 49 5e-04 CP000454_3615(CP000454|pid:none) Arthrobacter sp. FB24, complete... 49 6e-04 BX640423_316(BX640423|pid:none) Bordetella parapertussis strain ... 49 6e-04 CS354251_5(CS354251|pid:none) Sequence 113 from Patent WO2006024... 48 8e-04 AM920429_50(AM920429|pid:none) Penicillium chrysogenum Wisconsin... 48 0.001 CP000580_5572(CP000580|pid:none) Mycobacterium sp. JLS, complete... 47 0.002 CP000384_5222(CP000384|pid:none) Mycobacterium sp. MCS, complete... 47 0.002 CP000362_3333(CP000362|pid:none) Roseobacter denitrificans OCh 1... 47 0.002 AB078814_1(AB078814|pid:none) Aspergillus oryzae NMH gene for hy... 47 0.002 CP000774_1149(CP000774|pid:none) Parvibaculum lavamentivorans DS... 47 0.002 CP000699_4193(CP000699|pid:none) Sphingomonas wittichii RW1, com... 46 0.004 CP000249_2481(CP000249|pid:none) Frankia sp. CcI3, complete geno... 46 0.004 CP000386_1822(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 45 0.005 CP000272_1062(CP000272|pid:none) Burkholderia xenovorans LB400 c... 45 0.009 CP000152_1203(CP000152|pid:none) Burkholderia sp. 383 chromosome... 45 0.009 CP000152_3089(CP000152|pid:none) Burkholderia sp. 383 chromosome... 44 0.012 AM269952_36(AM269952|pid:none) Aspergillus niger contig An01c005... 44 0.012 CP000698_4285(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 44 0.012 CP000820_4722(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 44 0.020 CP000152_1201(CP000152|pid:none) Burkholderia sp. 383 chromosome... 44 0.020 CP000480_3839(CP000480|pid:none) Mycobacterium smegmatis str. MC... 43 0.027 CP000542_1486(CP000542|pid:none) Verminephrobacter eiseniae EF01... 43 0.027 CP000490_1556(CP000490|pid:none) Paracoccus denitrificans PD1222... 43 0.035 CP000529_1152(CP000529|pid:none) Polaromonas naphthalenivorans C... 42 0.046 CP000781_1328(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 41 0.10 CP000774_1150(CP000774|pid:none) Parvibaculum lavamentivorans DS... 41 0.10 CP001157_1100(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 41 0.13 CP001034_851(CP001034|pid:none) Natranaerobius thermophilus JW/N... 41 0.13 AP009384_2354(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 41 0.13 CP000721_3452(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 40 0.17 AE008691_2398(AE008691|pid:none) Thermoanaerobacter tengcongensi... 40 0.17 CP000613_3629(CP000613|pid:none) Rhodospirillum centenum SW, com... 40 0.23 CP000141_1299(CP000141|pid:none) Carboxydothermus hydrogenoforma... 39 0.39 AM167904_3291(AM167904|pid:none) Bordetella avium 197N complete ... 39 0.50 CP001389_3336(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 39 0.50 AB471639_28(AB471639|pid:none) Desulfotignum balticum genomic DN... 39 0.50 CP000092_304(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 39 0.66 CP000926_2396(CP000926|pid:none) Pseudomonas putida GB-1, comple... 39 0.66 CP000712_2222(CP000712|pid:none) Pseudomonas putida F1, complete... 38 0.86 AM902716_1105(AM902716|pid:none) Bordetella petrii strain DSM 12... 38 1.1 BA000012_3585(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 38 1.1 CP001341_135(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 38 1.1 DQ783207_1(DQ783207|pid:none) Uncultured bacterium clone T1R1_0-... 37 1.5 CP000489_467(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 37 1.5 DQ783122_1(DQ783122|pid:none) Uncultured bacterium clone T1D1_0-... 37 1.9 CP000580_5571(CP000580|pid:none) Mycobacterium sp. JLS, complete... 37 1.9 EU447969_1(EU447969|pid:none) Uncultured denitrifying bacterium ... 37 1.9 DQ783143_1(DQ783143|pid:none) Uncultured bacterium clone T1D2_0-... 37 1.9 DQ783260_1(DQ783260|pid:none) Uncultured bacterium clone T1R1_0-... 37 1.9 EU447949_1(EU447949|pid:none) Uncultured denitrifying bacterium ... 37 1.9 DQ783003_1(DQ783003|pid:none) Uncultured bacterium clone T1C1_0-... 37 2.5 CP000425_1286(CP000425|pid:none) Lactococcus lactis subsp. cremo... 37 2.5 CP000542_1793(CP000542|pid:none) Verminephrobacter eiseniae EF01... 37 2.5 DQ337724_1(DQ337724|pid:none) Uncultured bacterium clone B20m_ni... 37 2.5 EF016120_1(EF016120|pid:none) Nitrosospira tenuis strain Nv1 Nir... 37 2.5 AM406671_1167(AM406671|pid:none) Lactococcus lactis subsp. cremo... 37 2.5 AY576796_30(AY576796|pid:none) Actinoplanes phage phiAsp2, compl... 36 3.3 AP009245_5(AP009245|pid:none) Escherichia coli SE11 plasmid pSE1... 35 5.6 AF339044_1(AF339044|pid:none) Nitrosomonas sp. C-56 putative dis... 35 5.6 CP000817_2252(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 35 5.6 CP000656_1742(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 35 5.6 EU447942_1(EU447942|pid:none) Uncultured denitrifying bacterium ... 35 7.3 AF339045_1(AF339045|pid:none) Nitrosomonas sp. NO3W putative dis... 35 9.5 FM872307_711(FM872307|pid:none) Chlamydia trachomatis B/TZ1A828/... 35 9.5 AF339046_1(AF339046|pid:none) Nitrosomonas sp. URW putative diss... 35 9.5 (O84702) RecName: Full=Uncharacterized protein CT_696; &AE00127... 35 9.5 CP000051_725(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 35 9.5
>(Q54NW6) RecName: Full=5-oxoprolinase; EC=3.5.2.9; AltName: Full=5-oxo-L-prolinase; Short=5-OPase; AltName: Full=Pyroglutamase; Length = 1280
Score = 545 bits (1405), Expect = e-153 Identities = 278/303 (91%), Positives = 283/303 (93%) Frame = +2
Query: 602 DVVHAYMYHIQKNAELAVRDMLYDISISNNLKPLDTLISTDYMDDGSKIELKLTIDREKK 781 DVVHAYMYHIQKNAELAVRDMLYDISISNNLKPLDTLISTDYMDDGSKIELKLTIDREKK Sbjct: 965 DVVHAYMYHIQKNAELAVRDMLYDISISNNLKPLDTLISTDYMDDGSKIELKLTIDREKK 1024
Query: 782 SAIFDWSGSGVEVYGNTNAPTSITLSATIYSLRAMVKSEIPLNQGCLAPILTVIPPGSIL 961 SAIFDWSGSGVEVYGNTNAPTSITLSATIYSLRAMVKSEIPLNQGCLAPILTVIPPGSIL Sbjct: 1025 SAIFDWSGSGVEVYGNTNAPTSITLSATIYSLRAMVKSEIPLNQGCLAPILTVIPPGSIL 1084
Query: 962 NPSFDSAVVGGNVLTSQRLTDVILSAFGACANSQGCMNNLTFGDETLGYYETIAGGTGAG 1141 NPSFDSAVVGGNVLTSQRLTDVILSAFGACANSQGCMNNLTFGDETLGYYETIAGGTGAG Sbjct: 1085 NPSFDSAVVGGNVLTSQRLTDVILSAFGACANSQGCMNNLTFGDETLGYYETIAGGTGAG 1144
Query: 1142 PNFNGFTAVQSHMTNTRITDVEIMEKRYPVIVKEFSVRYXXXXXXXXXXXXXVVREIQFL 1321 PNFNGFTAVQSHMTNTRITDVEIMEKRYPVIVKEFSVRY VVREIQFL Sbjct: 1145 PNFNGFTAVQSHMTNTRITDVEIMEKRYPVIVKEFSVRYGSGGDGKFKGGDGVVREIQFL 1204
Query: 1322 KNFTVSILSERRSLQPRGLMGGENAERGLNLVLKNNGKYINIGSKNSINMKERINYNFYS 1501 KNFTVSILSERRSLQPRGLMGGENAERGLNLVLKNNGKYINIGSKNSIN++ + ++ Sbjct: 1205 KNFTVSILSERRSLQPRGLMGGENAERGLNLVLKNNGKYINIGSKNSINIERNESIIIFT 1264
Query: 1502 RGG 1510 GG Sbjct: 1265 PGG 1267
Score = 356 bits (913), Expect = 1e-96 Identities = 181/181 (100%), Positives = 181/181 (100%) Frame = +3
Query: 15 MTIDKLKKSIKFNIDRGGTFTDIYAEFPYEPYYIVEKLLSVDPENYSDAPREGIRRILER 194 MTIDKLKKSIKFNIDRGGTFTDIYAEFPYEPYYIVEKLLSVDPENYSDAPREGIRRILER Sbjct: 1 MTIDKLKKSIKFNIDRGGTFTDIYAEFPYEPYYIVEKLLSVDPENYSDAPREGIRRILER 60
Query: 195 IQGKSISKENVDTYAIKSIRMGTTVGTNALLERKGEKVLLVTSKGFRDLLQIGNQSRPKI 374 IQGKSISKENVDTYAIKSIRMGTTVGTNALLERKGEKVLLVTSKGFRDLLQIGNQSRPKI Sbjct: 61 IQGKSISKENVDTYAIKSIRMGTTVGTNALLERKGEKVLLVTSKGFRDLLQIGNQSRPKI 120
Query: 375 FELNITKPELIYNSVVELDERVQIVTNDQVLNDIKLESPNSLKKGTTGDYIKVLEIPNRD 554 FELNITKPELIYNSVVELDERVQIVTNDQVLNDIKLESPNSLKKGTTGDYIKVLEIPNRD Sbjct: 121 FELNITKPELIYNSVVELDERVQIVTNDQVLNDIKLESPNSLKKGTTGDYIKVLEIPNRD 180
Query: 555 K 557 K Sbjct: 181 K 181
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 2,298,921,588 Number of extensions: 44869433 Number of successful extensions: 149754 Number of sequences better than 10.0: 378 Number of HSP's gapped: 149104 Number of HSP's successfully gapped: 470 Length of query: 509 Length of database: 1,040,966,779 Length adjustment: 133 Effective length of query: 376 Effective length of database: 614,796,874 Effective search space: 231163624624 Effective search space used: 231163624624 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|