| Contig-U13065-1 |
| Contig ID |
Contig-U13065-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
718 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
3561021 |
| End point |
3561729 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
1 |
| Number of EST |
1 |
| Link to clone list |
U13065 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12. 6 |
| Homology vs DNA |
Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d
(718 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ382904) Dictyostelium discoideum cDNA clone:ddc46c08, 3' ... 1403 0.0 1
(BJ406668) Dictyostelium discoideum cDNA clone:dds36e02, 3' ... 920 0.0 3
(BJ349596) Dictyostelium discoideum cDNA clone:dda37b06, 3' ... 902 0.0 2
(BJ385859) Dictyostelium discoideum cDNA clone:ddc56k09, 3' ... 852 0.0 2
(BJ357873) Dictyostelium discoideum cDNA clone:dda65a06, 3' ... 837 0.0 2
(BJ355185) Dictyostelium discoideum cDNA clone:dda56c01, 3' ... 829 0.0 2
(BJ385771) Dictyostelium discoideum cDNA clone:ddc56h05, 3' ... 797 0.0 2
(BJ407596) Dictyostelium discoideum cDNA clone:dds43f04, 3' ... 793 0.0 3
(BJ407759) Dictyostelium discoideum cDNA clone:dds43e18, 3' ... 789 0.0 4
(BJ386627) Dictyostelium discoideum cDNA clone:ddc58j22, 3' ... 789 0.0 3
(BJ386224) Dictyostelium discoideum cDNA clone:ddc57d16, 3' ... 789 0.0 2
(BJ382565) Dictyostelium discoideum cDNA clone:ddc45m02, 3' ... 789 0.0 3
(BJ404352) Dictyostelium discoideum cDNA clone:dds28b12, 3' ... 787 0.0 2
(BJ347840) Dictyostelium discoideum cDNA clone:dda31i10, 3' ... 787 0.0 2
(BJ386213) Dictyostelium discoideum cDNA clone:ddc57b16, 3' ... 785 0.0 3
(BJ355908) Dictyostelium discoideum cDNA clone:dda58i16, 3' ... 785 0.0 3
(BJ351308) Dictyostelium discoideum cDNA clone:dda42b20, 3' ... 783 0.0 2
(BJ406948) Dictyostelium discoideum cDNA clone:dds37a03, 3' ... 781 0.0 3
(BJ384487) Dictyostelium discoideum cDNA clone:ddc49k14, 3' ... 781 0.0 3
(BJ383085) Dictyostelium discoideum cDNA clone:ddc46g20, 3' ... 781 0.0 2
(BJ348121) Dictyostelium discoideum cDNA clone:dda32b12, 3' ... 781 0.0 2
(BJ349724) Dictyostelium discoideum cDNA clone:dda37n12, 3' ... 779 0.0 3
(BJ353196) Dictyostelium discoideum cDNA clone:dda49f08, 3' ... 777 0.0 3
(BJ386075) Dictyostelium discoideum cDNA clone:ddc57g03, 3' ... 773 0.0 3
(BJ379201) Dictyostelium discoideum cDNA clone:ddc34h03, 3' ... 771 0.0 2
(BJ409264) Dictyostelium discoideum cDNA clone:dds40i08, 3' ... 735 0.0 2
(BJ352589) Dictyostelium discoideum cDNA clone:dda47b09, 3' ... 729 0.0 3
(BJ351106) Dictyostelium discoideum cDNA clone:dda42f05, 3' ... 728 0.0 3
(BJ442556) Dictyostelium discoideum cDNA clone:ddv50c07, 3' ... 726 0.0 4
(BJ358255) Dictyostelium discoideum cDNA clone:dda56e20, 3' ... 724 0.0 2
(BJ409661) Dictyostelium discoideum cDNA clone:dds42h20, 3' ... 720 0.0 3
(BJ378757) Dictyostelium discoideum cDNA clone:ddc32a23, 3' ... 710 0.0 2
(BJ384704) Dictyostelium discoideum cDNA clone:ddc50m10, 3' ... 700 0.0 4
(BJ380042) Dictyostelium discoideum cDNA clone:ddc36f21, 3' ... 700 0.0 2
(BJ355954) Dictyostelium discoideum cDNA clone:dda58c20, 3' ... 688 0.0 2
(BJ404723) Dictyostelium discoideum cDNA clone:dds29n07, 3' ... 674 0.0 2
(BJ436445) Dictyostelium discoideum cDNA clone:ddv31o01, 3' ... 658 0.0 4
(BJ386621) Dictyostelium discoideum cDNA clone:ddc58i21, 3' ... 535 0.0 3
(BJ379612) Dictyostelium discoideum cDNA clone:ddc35n07, 3' ... 664 0.0 3
(BJ405546) Dictyostelium discoideum cDNA clone:dds32e06, 3' ... 644 0.0 2
(BJ378915) Dictyostelium discoideum cDNA clone:ddc33a12, 3' ... 936 0.0 2
(BJ342106) Dictyostelium discoideum cDNA clone:dda9e13, 3' e... 898 0.0 2
(BJ357241) Dictyostelium discoideum cDNA clone:dda62k22, 3' ... 476 0.0 2
(BJ358214) Dictyostelium discoideum cDNA clone:dda43k02, 3' ... 541 0.0 2
(BJ379088) Dictyostelium discoideum cDNA clone:ddc33a23, 3' ... 876 0.0 1
(BJ349839) Dictyostelium discoideum cDNA clone:dda37f23, 3' ... 476 0.0 2
(BJ355952) Dictyostelium discoideum cDNA clone:dda58b24, 3' ... 442 0.0 2
(BJ381931) Dictyostelium discoideum cDNA clone:ddc43k08, 3' ... 450 0.0 3
(BJ437103) Dictyostelium discoideum cDNA clone:ddv33o06, 3' ... 406 0.0 2
(BJ409304) Dictyostelium discoideum cDNA clone:dds40a21, 3' ... 426 0.0 2
(BJ438396) Dictyostelium discoideum cDNA clone:ddv37e21, 3' ... 176 1e-96 3
(BJ442974) Dictyostelium discoideum cDNA clone:ddv51c16, 3' ... 155 4e-87 3
(BJ409255) Dictyostelium discoideum cDNA clone:dds40e08, 3' ... 188 2e-43 1
(EC761186) PSE00006759 rw_mgpallid Polysphondylium pallidum ... 64 8e-06 1
(FF507166) G709P5214RF9.T0 Acorn worm normalized neurula pEx... 44 0.25 2
(AM458700) Vitis vinifera, whole genome shotgun sequence, co... 46 1.8 1
(AC221792) Bos taurus clone CH240-385G2, WORKING DRAFT SEQUE... 46 1.8 1
(AC177571) Bos taurus clone CH240-382D15, WORKING DRAFT SEQU... 46 1.8 1
(FD900013) CBHO9868.fwd CBHO Volvox carteri f. nagariensis f... 46 1.8 1
(AC198446) Glycine max clone gmw2-129e12, complete sequence. 32 3.5 2
(AM466264) Vitis vinifera, whole genome shotgun sequence, co... 42 6.4 3
(DY301183) KN0AAQ12YG10RM1 CitNFL Citrus clementina cDNA 5',... 42 6.4 2
(AC092840) Homo sapiens BAC clone RP11-258O11 from 2, comple... 44 7.1 1
(AC069057) Homo sapiens chromosome 2 clone RP11-156G21 map 2... 44 7.1 1
(AC220471) Bos taurus clone CH240-357D13, WORKING DRAFT SEQU... 44 7.1 1
(ET670581) MUGQ_CH252P462O24Sp6_CH00125_082 CHORI-252 Vervet... 44 7.1 1
(ET657753) MUGQ_CH252P441N14Sp6_CP847_051 CHORI-252 Vervet M... 44 7.1 1
(EK112904) 1092963138958 Global-Ocean-Sampling_GS-31-01-01-1... 44 7.1 1
(CE252391) tigr-gss-dog-17000335928176 Dog Library Canis lup... 44 7.1 1
(BH795066) ME_MBa0003O21r Manihot esculenta Manihot esculent... 44 7.1 1
(EV112599) 0117911 Brassica napus Senescent leaves Brassica ... 44 7.1 1
(BJ668296) Eptatretus burgeri leukocyte cDNA clone:hg140l05,... 44 7.1 1
(BJ658083) Eptatretus burgeri leukocyte cDNA clone:hg106h05,... 44 7.1 1
(FK881417) EST_crog_evp_903533 crog_evp Caligus rogercressey... 44 7.1 1
(FK877293) EST_crog_evp_911718 crog_evp Caligus rogercressey... 44 7.1 1
(FD893568) CBHO4876.fwd CBHO Volvox carteri f. nagariensis f... 44 7.1 1
(FD869943) CBHO14801.fwd CBHO Volvox carteri f. nagariensis ... 44 7.1 1
(FD869942) CBHO14801.rev CBHO Volvox carteri f. nagariensis ... 44 7.1 1
(FD832453) CBGZ34250.rev CBGZ Volvox carteri f. nagariensis ... 44 7.1 1
(FD801665) CBGX461.rev CBGX Volvox carteri f. nagariensis in... 44 7.1 1
(EW747232) sb_005_04A10_m13reverselong Onychiurus arcticus c... 44 7.1 1
(EV545283) RR3AQ06JQ RR3(NY) Raphanus raphanistrum subsp. ra... 44 7.1 1
(CT967302) M.truncatula DNA sequence from clone MTH2-146M13 ... 40 7.4 2
(AC141534) Rattus norvegicus clone CH230-504H4, WORKING DRAF... 36 9.9 6
>(BJ382904) Dictyostelium discoideum cDNA clone:ddc46c08, 3' end,
single read.
Length = 709
Score = 1404 bits (708), Expect = 0.0
Identities = 708/708 (100%)
Strand = Plus / Minus
Query: 11 caatcaaagcaatcaatggtaaattaactttgttaccattctattacacattgttccata 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 709 caatcaaagcaatcaatggtaaattaactttgttaccattctattacacattgttccata 650
Query: 71 tttctcatgtttctggtgatccagttgttagaccattattctttgaatatccatcagatc 130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 649 tttctcatgtttctggtgatccagttgttagaccattattctttgaatatccatcagatc 590
Query: 131 caaatacttttgcaattgatcaacaatttttagttggtacaggtttaatggtatcaccag 190
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 589 caaatacttttgcaattgatcaacaatttttagttggtacaggtttaatggtatcaccag 530
Query: 191 ttctcactcaaggtgctaccacagtgaatgcttacttcccaaatgatatctggtatgaat 250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 529 ttctcactcaaggtgctaccacagtgaatgcttacttcccaaatgatatctggtatgaat 470
Query: 251 atggtaatggttcattggttcaatcagttggtacccatcaaactttaaatgctccattcg 310
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 469 atggtaatggttcattggttcaatcagttggtacccatcaaactttaaatgctccattcg 410
Query: 311 atgtaatcaacgttcatatgcgtggtggtaatatcattccaactcaaccaacctcctcat 370
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 409 atgtaatcaacgttcatatgcgtggtggtaatatcattccaactcaaccaacctcctcat 350
Query: 371 atgttacaccagttgatggtattccaattaccactaaaatctctagaactttaccatttg 430
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 349 atgttacaccagttgatggtattccaattaccactaaaatctctagaactttaccatttg 290
Query: 431 aattgattattgccttggattcttcattacaagcaactggtcaattattcttcatctgcc 490
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 289 aattgattattgccttggattcttcattacaagcaactggtcaattattcttcatctgcc 230
Query: 491 tacaaattacaatcaaccattctcaataacaattataatggtaccgcttctttaatcatt 550
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 229 tacaaattacaatcaaccattctcaataacaattataatggtaccgcttctttaatcatt 170
Query: 551 aattctatccaaatctacggttcgccatcagttcaacaagtcattgttaatggtagccca 610
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 169 aattctatccaaatctacggttcgccatcagttcaacaagtcattgttaatggtagccca 110
Query: 611 atcaattcatttaatgctgtttctgattcaactctctctgtttcaaatttacaacttgct 670
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 109 atcaattcatttaatgctgtttctgattcaactctctctgtttcaaatttacaacttgct 50
Query: 671 ttagatgaatcctttgaagttgattttgtattatattaaaaattatca 718
||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 49 ttagatgaatcctttgaagttgattttgtattatattaaaaattatca 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 784,685,271
Number of extensions: 44502526
Number of successful extensions: 3563532
Number of sequences better than 10.0: 84
Length of query: 718
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 694
Effective length of database: 97,308,875,965
Effective search space: 67532359919710
Effective search space used: 67532359919710
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7. 5 |
| Homology vs Protein |
Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d
(718 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB000967_1(AB000967|pid:none) Coturnix japonica GAAI mRNA for ac... 137 4e-31
AF118226_1(AF118226|pid:none) Hordeum vulgare high pI alpha-gluc... 135 1e-30
AM430903_1(AM430903|pid:none) Vitis vinifera contig VV78X052784.... 133 5e-30
EU955937_1(EU955937|pid:none) Zea mays clone 1553282 unknown mRNA. 132 8e-30
(Q43763) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 131 2e-29
AB006754_1(AB006754|pid:none) Coturnix japonica GAAII mRNA for a... 130 3e-29
(Q6P7A9) RecName: Full=Lysosomal alpha-glucosidase; EC=... 130 5e-29
AF448201_1(AF448201|pid:none) Pinus pinaster putative alpha-xylo... 129 7e-29
(P70699) RecName: Full=Lysosomal alpha-glucosidase; EC=... 128 2e-28
BC010210_1(BC010210|pid:none) Mus musculus glucosidase, alpha, a... 128 2e-28
AF016833_1(AF016833|pid:none) Homo sapiens maltase-glucoamylase ... 124 1e-27
(O43451) RecName: Full=Maltase-glucoamylase, intestinal; Include... 124 1e-27
EU530574_1(EU530574|pid:none) Thermomyces lanuginosus alpha-gluc... 124 2e-27
U49351_1(U49351|pid:none) Mus musculus lysosomal alpha-glucosida... 124 2e-27
(Q653V7) RecName: Full=Probable alpha-glucosidase Os06g0675700; ... 124 3e-27
(Q6ZN80) RecName: Full=Putative maltase-glucoamylase-like protei... 123 5e-27
AL163814_11(AL163814|pid:none) Arabidopsis thaliana DNA chromoso... 123 5e-27
AF014806_1(AF014806|pid:none) Arabidopsis thaliana alpha-glucosi... 123 5e-27
EU937530_1(EU937530|pid:none) Mus musculus sucrase-isomaltase mR... 114 2e-26
AM269980_112(AM269980|pid:none) Aspergillus niger contig An01c03... 120 3e-26
(Q5R7A9) RecName: Full=Lysosomal alpha-glucosidase; EC=... 120 5e-26
DQ490470_1(DQ490470|pid:none) Emericella nidulans alpha-glucosid... 119 9e-26
DQ907243_1(DQ907243|pid:none) Homo sapiens alpha-glucosidase (GA... 118 2e-25
AX840238_1(AX840238|pid:none) Sequence 12 from Patent WO03073839. 118 2e-25
A32609(A40577;A32609;A35698;S00831;S18847;I52309;S63526) alpha-g... 118 2e-25
L25926_1(L25926|pid:none) Rat sucrase-isomaltase (SI) mRNA, comp... 115 2e-25
(P23739) RecName: Full=Sucrase-isomaltase, intestinal; Contains:... 115 2e-25
AB428422_1(AB428422|pid:none) Felis catus SI mRNA for sucrase-is... 117 3e-25
(Q09901) RecName: Full=Uncharacterized family 31 glucosidase C30... 117 5e-25
AB057452_1(AB057452|pid:none) Physcomitrella patens subsp. paten... 115 1e-24
(Q9URX4) RecName: Full=Uncharacterized family 31 glucosidase C10... 115 1e-24
BC115034_1(BC115034|pid:none) Homo sapiens sucrase-isomaltase (a... 114 2e-24
(P14410) RecName: Full=Sucrase-isomaltase, intestinal; Contains:... 114 2e-24
BC116452_1(BC116452|pid:none) Homo sapiens sucrase-isomaltase (a... 114 2e-24
UUHU(S36082;A27326;S24329;A61136) sucrose alpha-glucosidase (EC ... 114 2e-24
AM920437_1235(AM920437|pid:none) Penicillium chrysogenum Wiscons... 114 4e-24
FM992688_951(FM992688|pid:none) Candida dubliniensis CD36 chromo... 113 7e-24
(Q12558) RecName: Full=Alpha-glucosidase; Short=AGL; ... 111 2e-23
AM920435_958(AM920435|pid:none) Penicillium chrysogenum Wisconsi... 110 3e-23
DQ490507_1(DQ490507|pid:none) Emericella nidulans alpha/beta-glu... 110 4e-23
(Q9C0Y4) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 110 6e-23
AB045751_1(AB045751|pid:none) Schizosaccharomyces pombe agl mRNA... 110 6e-23
AM920436_1367(AM920436|pid:none) Penicillium chrysogenum Wiscons... 108 1e-22
CR382136_139(CR382136|pid:none) Debaryomyces hansenii strain CBS... 108 1e-22
(P56526) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 108 2e-22
AB090361_1(AB090361|pid:none) Mortierella alliacea agdA mRNA for... 108 2e-22
AB232696_1(AB232696|pid:none) Debaryomyces occidentalis GAM1 gen... 107 4e-22
AJ131520_1(AJ131520|pid:none) Tropaeolum majus mRNA for alpha-D-... 107 4e-22
JC1200(JC1200)alpha-glucosidase (EC 3.2.1.20) chain P2 - Aspergi... 107 5e-22
(P22861) RecName: Full=Glucoamylase 1; EC=3.2.1.3; AltN... 107 5e-22
AB007646_4(AB007646|pid:none) Arabidopsis thaliana genomic DNA, ... 107 5e-22
AM467592_1(AM467592|pid:none) Vitis vinifera contig VV78X160209.... 105 1e-21
AM920436_2320(AM920436|pid:none) Penicillium chrysogenum Wiscons... 105 1e-21
AE015928_3085(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 104 3e-21
T15893(T15893)hypothetical protein D2096.3 - Caenorhabditis eleg... 103 4e-21
AJ250828_1(AJ250828|pid:none) Penaeus vannamei mRNA for alpha gl... 103 4e-21
(Q92442) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 103 5e-21
AP007169_394(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 102 9e-21
(O62653) RecName: Full=Sucrase-isomaltase, intestinal; Contains:... 102 1e-20
BX294013_13(BX294013|pid:none) Neurospora crassa DNA linkage gro... 101 3e-20
CU640366_6(CU640366|pid:none) Podospora anserina genomic DNA chr... 101 3e-20
BT086563_1(BT086563|pid:none) Zea mays full-length cDNA clone ZM... 100 4e-20
AM270207_11(AM270207|pid:none) Aspergillus niger contig An09c018... 99 2e-19
BX842632_3(BX842632|pid:none) Neurospora crassa DNA linkage grou... 97 4e-19
AB057788_1(AB057788|pid:none) Aspergillus nidulans gene for alph... 97 6e-19
AJ580825_1(AJ580825|pid:none) Arxula adeninivorans ainv gene for... 96 8e-19
BC130137_1(BC130137|pid:none) Xenopus laevis hypothetical protei... 96 8e-19
CP000497_413(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 96 1e-18
CP000685_4396(CP000685|pid:none) Flavobacterium johnsoniae UW101... 96 1e-18
AL844608_9(AL844608|pid:none) Mouse DNA sequence from clone RP23... 95 2e-18
(Q8BVW0) RecName: Full=Neutral alpha-glucosidase C; EC=... 95 2e-18
FN357329_50(FN357329|pid:none) Schistosoma mansoni genome sequen... 95 2e-18
CP001575_534(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 95 2e-18
AK102309_1(AK102309|pid:none) Oryza sativa Japonica Group cDNA c... 94 3e-18
AP002526_7(AP002526|pid:none) Oryza sativa Japonica Group genomi... 94 3e-18
BC155700_1(BC155700|pid:none) Xenopus tropicalis hypothetical pr... 94 4e-18
AB173690_1(AB173690|pid:none) Macaca fascicularis brain cDNA clo... 93 7e-18
CP001160_208(CP001160|pid:none) Thalassiosira pseudonana CCMP133... 93 7e-18
AJ606313_1(AJ606313|pid:none) Lycopersicon esculentum mRNA for a... 93 7e-18
FN357326_54(FN357326|pid:none) Schistosoma mansoni genome sequen... 93 7e-18
CU633457_192(CU633457|pid:none) Podospora anserina genomic DNA c... 92 2e-17
CU633438_718(CU633438|pid:none) Podospora anserina genomic DNA c... 92 2e-17
AY811321_1(AY811321|pid:none) Schistosoma japonicum SJCHGC05582 ... 92 2e-17
BC152014_1(BC152014|pid:none) Danio rerio zgc:171967, mRNA (cDNA... 91 3e-17
AC141112_18(AC141112|pid:none) Medicago truncatula clone mth2-15... 91 4e-17
BC128069_1(BC128069|pid:none) Mus musculus alpha glucosidase 2 a... 91 5e-17
(Q8BHN3) RecName: Full=Neutral alpha-glucosidase AB; EC... 91 5e-17
AK295899_1(AK295899|pid:none) Homo sapiens cDNA FLJ61290 complet... 90 6e-17
AK299819_1(AK299819|pid:none) Homo sapiens cDNA FLJ54057 complet... 90 6e-17
AF144074_1(AF144074|pid:none) Homo sapiens glucosidase II alpha ... 90 6e-17
(Q94502) RecName: Full=Neutral alpha-glucosidase AB; EC... 90 6e-17
AB383744_1(AB383744|pid:none) Synthetic construct DNA, clone: pF... 90 6e-17
AP008209_743(AP008209|pid:none) Oryza sativa (japonica cultivar-... 90 6e-17
BC017433_1(BC017433|pid:none) Homo sapiens glucosidase, alpha; n... 90 6e-17
AF545046_1(AF545046|pid:none) Homo sapiens neutral alpha-glucosi... 90 8e-17
BC148865_1(BC148865|pid:none) Bos taurus glucosidase, alpha; neu... 90 8e-17
AF545044_1(AF545044|pid:none) Synthetic construct neutral alpha ... 90 8e-17
AK074037_1(AK074037|pid:none) Homo sapiens mRNA for FLJ00088 pro... 90 8e-17
AF545047_1(AF545047|pid:none) Synthetic construct neutral alpha ... 90 8e-17
(Q8TET4) RecName: Full=Neutral alpha-glucosidase C; EC=... 90 8e-17
(Q9BE70) RecName: Full=Neutral alpha-glucosidase C; EC=... 89 1e-16
AB056800_1(AB056800|pid:none) Macaca fascicularis brain cDNA clo... 89 1e-16
(Q9F234) RecName: Full=Alpha-glucosidase 2; EC=3.2.1.20... 89 1e-16
T22575(T22575)hypothetical protein F53F4.8 - Caenorhabditis eleg... 89 2e-16
BT061767_1(BT061767|pid:none) Zea mays full-length cDNA clone ZM... 88 2e-16
BT067722_1(BT067722|pid:none) Zea mays full-length cDNA clone ZM... 88 3e-16
FM992692_24(FM992692|pid:none) Candida dubliniensis CD36 chromos... 87 5e-16
AB365478_1(AB365478|pid:none) Gibberella fujikuroi mRNA for alph... 87 7e-16
CP000139_1756(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 87 7e-16
CR382134_348(CR382134|pid:none) Debaryomyces hansenii strain CBS... 86 9e-16
AJ252161_6(AJ252161|pid:none) Alicyclobacillus acidocaldarius ma... 86 1e-15
CT005257_9(CT005257|pid:none) Leishmania major strain Friedlin, ... 85 2e-15
CP000923_6(CP000923|pid:none) Thermoanaerobacter sp. X514, compl... 84 4e-15
CP000924_6(CP000924|pid:none) Thermoanaerobacter pseudethanolicu... 84 4e-15
FN392320_834(FN392320|pid:none) Pichia pastoris GS115 chromosome... 84 4e-15
CP001037_2212(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 83 7e-15
CP000240_1345(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 82 1e-14
CR380957_296(CR380957|pid:none) Candida glabrata strain CBS138 c... 82 2e-14
AL807368_1(AL807368|pid:none) Neurospora crassa DNA linkage grou... 81 3e-14
CU928180_269(CU928180|pid:none) Kluyveromyces thermotolerans str... 81 4e-14
CP000501_308(CP000501|pid:none) Pichia stipitis CBS 6054 chromos... 80 5e-14
CP000386_2062(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 80 6e-14
CP000246_2281(CP000246|pid:none) Clostridium perfringens ATCC 13... 80 8e-14
S11386(S11386;S33657)sucrose alpha-glucosidase (EC 3.2.1.48) - r... 80 8e-14
T27893(T27893)hypothetical protein ZK546.9 - Caenorhabditis eleg... 79 1e-13
(P38138) RecName: Full=Glucosidase 2 subunit alpha; EC=... 79 1e-13
CR954205_314(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 79 1e-13
T32449(T32449)hypothetical protein F52D1.1 - Caenorhabditis eleg... 79 1e-13
AF026208_3(AF026208|pid:none) Caenorhabditis elegans cosmid F52D... 79 1e-13
AB038780_1(AB038780|pid:none) Bacillus thermoamyloliquefaciens B... 78 2e-13
T22044(T22044) hypothetical protein F40F9.6a - Caenorhabditis el... 78 3e-13
AE016814_361(AE016814|pid:none) Ashbya gossypii (= Eremothecium ... 77 4e-13
BA000030_2576(BA000030|pid:none) Streptomyces avermitilis MA-468... 77 7e-13
AB161945_2(AB161945|pid:none) Arthrobacter globiformis ctsR, cts... 77 7e-13
CP000473_1770(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 76 9e-13
CR382126_421(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 76 1e-12
AB089152_2(AB089152|pid:none) Sporosarcina globispora ctsX, ctsY... 75 3e-12
CP001107_480(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 75 3e-12
AB073929_5(AB073929|pid:none) Sporosarcina globispora ctsU, ctsV... 74 6e-12
CP000360_387(CP000360|pid:none) Acidobacteria bacterium Ellin345... 73 8e-12
AG1460(AG1460) alpha-glucosidase homolog lin0222 [imported] - Li... 73 8e-12
CP001291_1860(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 73 8e-12
CP000922_2162(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 73 8e-12
AJ619756_1(AJ619756|pid:none) Ustilago maydis gas1 gene for alph... 73 1e-11
CP000140_3447(CP000140|pid:none) Parabacteroides distasonis ATCC... 73 1e-11
CU234118_4162(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 73 1e-11
CP000561_902(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 72 2e-11
CP001634_575(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 72 2e-11
CU207366_2953(CU207366|pid:none) Gramella forsetii KT0803 comple... 72 2e-11
CP001071_1837(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 72 2e-11
CP000585_304(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 72 2e-11
AM746676_3453(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 72 2e-11
BA000045_197(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 71 4e-11
AE001437_2222(AE001437|pid:none) Clostridium acetobutylicum ATCC... 70 5e-11
AE015928_3084(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 70 5e-11
AM039952_1805(AM039952|pid:none) Xanthomonas campestris pv. vesi... 70 7e-11
AG1749(AG1749) glycosidase homolog lin2540 [imported] - Listeria... 69 1e-10
CP000660_1973(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 69 1e-10
CP000967_1686(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 69 1e-10
AE001437_2846(AE001437|pid:none) Clostridium acetobutylicum ATCC... 69 1e-10
AE013598_2854(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 69 1e-10
AB072762_1(AB072762|pid:none) Macaca fascicularis testis cDNA cl... 69 2e-10
CP000360_896(CP000360|pid:none) Acidobacteria bacterium Ellin345... 69 2e-10
AF1380(AF1380) glycosidase homolog lmo2446 [imported] - Listeria... 68 2e-10
CP001402_2305(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 68 3e-10
AE017222_219(AE017222|pid:none) Thermus thermophilus HB27 plasmi... 68 3e-10
AY059821_1(AY059821|pid:none) Arabidopsis thaliana alpha glucosi... 68 3e-10
CP001399_2310(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 68 3e-10
AJ621310_1(AJ621310|pid:none) Thermoproteus tenax malZ gene for ... 67 4e-10
AM184115_25(AM184115|pid:none) Uncultured Thermotogales bacteriu... 67 4e-10
L43051_1(L43051|pid:none) Tetrahymena pyriformis antigen mRNA, c... 67 4e-10
AB089152_3(AB089152|pid:none) Sporosarcina globispora ctsX, ctsY... 60 5e-10
CP001175_2428(CP001175|pid:none) Listeria monocytogenes HCC23, c... 67 6e-10
CP000685_774(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 67 6e-10
CP000504_1759(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 67 7e-10
CP000746_147(CP000746|pid:none) Actinobacillus succinogenes 130Z... 67 7e-10
CP000413_1600(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 67 7e-10
CP000500_11(CP000500|pid:none) Pichia stipitis CBS 6054 chromoso... 67 7e-10
AH1097(AH1097) alpha-glucosidase homolog lmo0183 [imported] - Li... 66 9e-10
CP000749_2751(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 66 9e-10
FJ839817_1(FJ839817|pid:none) Lactobacillus johnsonii strain NBR... 66 9e-10
AP007154_581(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 66 1e-09
AE009441_1356(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 65 2e-09
AM920689_2539(AM920689|pid:none) Xanthomonas campestris pv. camp... 65 2e-09
FM242711_2376(FM242711|pid:none) Listeria monocytogenes Clip8145... 65 2e-09
CP001504_386(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 65 2e-09
AE008922_1727(AE008922|pid:none) Xanthomonas campestris pv. camp... 65 2e-09
AE017198_1672(AE017198|pid:none) Lactobacillus johnsonii NCC 533... 65 2e-09
CP001403_2422(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 65 2e-09
CP001404_396(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 65 2e-09
BC005405_1(BC005405|pid:none) Homo sapiens glucosidase, alpha; n... 65 2e-09
CP000880_2008(CP000880|pid:none) Salmonella enterica subsp. ariz... 65 2e-09
AE017263_318(AE017263|pid:none) Mesoplasma florum L1 complete ge... 65 3e-09
AE017333_2014(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 65 3e-09
BA000045_1535(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 64 4e-09
CP000647_827(CP000647|pid:none) Klebsiella pneumoniae subsp. pne... 64 4e-09
AP007281_972(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 64 5e-09
AY857617_5(AY857617|pid:none) Escherichia coli strain BEN2908 tR... 64 5e-09
CP001616_2847(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 64 5e-09
CP001175_151(CP001175|pid:none) Listeria monocytogenes HCC23, co... 64 5e-09
AE017262_2393(AE017262|pid:none) Listeria monocytogenes str. 4b ... 64 5e-09
AE014075_4402(AE014075|pid:none) Escherichia coli CFT073, comple... 64 5e-09
AD1380(AD1380) glycosidase homolog lmo2444 [imported] - Listeria... 64 5e-09
CP000964_3648(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 64 5e-09
CP000852_1629(CP000852|pid:none) Caldivirga maquilingensis IC-16... 64 5e-09
CP000422_177(CP000422|pid:none) Pediococcus pentosaceus ATCC 257... 64 6e-09
CP001404_425(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 63 8e-09
CP001399_2288(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 63 8e-09
(O59645) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 63 8e-09
CP000916_380(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 63 8e-09
CP001403_2392(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 63 8e-09
CP001400_2146(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 63 8e-09
EF642981_1(EF642981|pid:none) Nicotiana langsdorffii x Nicotiana... 62 1e-08
AM238663_1052(AM238663|pid:none) Streptomyces ambofaciens ATCC 2... 62 1e-08
CP000826_3584(CP000826|pid:none) Serratia proteamaculans 568, co... 62 1e-08
CP001185_1781(CP001185|pid:none) Thermosipho africanus TCF52B, c... 62 2e-08
CP000439_888(CP000439|pid:none) Francisella tularensis subsp. no... 62 2e-08
CP000970_4091(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 62 2e-08
BA000023_2698(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 62 2e-08
AE1749(AE1749) glycosidase homolog lin2538 [imported] - Listeria... 62 2e-08
AK121014_1(AK121014|pid:none) Oryza sativa Japonica Group cDNA c... 62 2e-08
CP000507_156(CP000507|pid:none) Shewanella amazonensis SB2B, com... 62 2e-08
CP000885_3741(CP000885|pid:none) Clostridium phytofermentans ISD... 62 2e-08
AB073929_6(AB073929|pid:none) Sporosarcina globispora ctsU, ctsV... 62 2e-08
CP000416_130(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 62 2e-08
CP000386_2522(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 61 4e-08
CP000934_3179(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 61 4e-08
CP000687_989(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 61 4e-08
FM242711_181(FM242711|pid:none) Listeria monocytogenes Clip81459... 61 4e-08
AE005674_3952(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 60 5e-08
L19201_21(L19201|pid:none) E. coli chromosomal region from 87.2 ... 60 5e-08
AP008213_812(AP008213|pid:none) Oryza sativa (japonica cultivar-... 60 5e-08
AP009240_4161(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 60 7e-08
CP001068_931(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 60 7e-08
DQ490509_1(DQ490509|pid:none) Emericella nidulans alpha-xylosida... 60 7e-08
CP000720_904(CP000720|pid:none) Yersinia pseudotuberculosis IP 3... 60 9e-08
BX936398_3091(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 60 9e-08
BA000030_6976(BA000030|pid:none) Streptomyces avermitilis MA-468... 60 9e-08
CP000950_964(CP000950|pid:none) Yersinia pseudotuberculosis YPII... 60 9e-08
AD0104(AD0104) probable glucosidase YPO0848 [imported] - Yersini... 60 9e-08
CP000305_3044(CP000305|pid:none) Yersinia pestis Nepal516, compl... 60 9e-08
CP001048_3171(CP001048|pid:none) Yersinia pseudotuberculosis PB1... 60 9e-08
AP009493_6135(AP009493|pid:none) Streptomyces griseus subsp. gri... 59 1e-07
BX950851_1946(BX950851|pid:none) Erwinia carotovora subsp. atros... 59 1e-07
AE016827_539(AE016827|pid:none) Mannheimia succiniciproducens MB... 59 1e-07
CP001107_479(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 59 1e-07
CP000386_694(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 59 1e-07
CP000750_411(CP000750|pid:none) Kineococcus radiotolerans SRS302... 59 1e-07
CR378676_14(CR378676|pid:none) Photobacterium profundum SS9 chro... 59 2e-07
CP000152_1869(CP000152|pid:none) Burkholderia sp. 383 chromosome... 59 2e-07
BA000004_2055(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 59 2e-07
CP000088_1608(CP000088|pid:none) Thermobifida fusca YX, complete... 59 2e-07
FM211187_279(FM211187|pid:none) Streptococcus pneumoniae ATCC 70... 58 3e-07
CP000388_2322(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 58 3e-07
CP000921_340(CP000921|pid:none) Streptococcus pneumoniae Taiwan1... 57 4e-07
CP000721_4571(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 57 4e-07
CP000919_287(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 57 4e-07
CP000721_4573(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 57 4e-07
AE005672_300(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 57 4e-07
AE007317_284(AE007317|pid:none) Streptococcus pneumoniae R6, com... 57 4e-07
CP000936_401(CP000936|pid:none) Streptococcus pneumoniae Hungary... 57 4e-07
CP001127_3929(CP001127|pid:none) Salmonella enterica subsp. ente... 57 4e-07
AL939107_199(AL939107|pid:none) Streptomyces coelicolor A3(2) co... 57 4e-07
CP000875_1242(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 57 6e-07
U89276_2(U89276|pid:none) Lactobacillus pentosus isoprimeverose ... 57 6e-07
AE005174_4833(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 57 6e-07
AB240194_1(AB240194|pid:none) Hordeum vulgare Agl3 mRNA for alph... 57 6e-07
CP001615_1464(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 57 7e-07
AM711867_117(AM711867|pid:none) Clavibacter michiganensis subsp.... 57 7e-07
CR954208_374(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 57 7e-07
BA000011_1325(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 57 7e-07
CP001098_941(CP001098|pid:none) Halothermothrix orenii H 168, co... 57 7e-07
CP001120_39(CP001120|pid:none) Salmonella enterica subsp. enteri... 56 1e-06
CP000934_2642(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 56 1e-06
CP000083_950(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 56 1e-06
AE005673_786(AE005673|pid:none) Caulobacter crescentus CB15, com... 56 1e-06
CP001127_44(CP001127|pid:none) Salmonella enterica subsp. enteri... 56 1e-06
CP000822_3047(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 56 1e-06
CP001120_4047(CP001120|pid:none) Salmonella enterica subsp. ente... 56 1e-06
AE017220_3910(AE017220|pid:none) Salmonella enterica subsp. ente... 56 1e-06
AM711867_374(AM711867|pid:none) Clavibacter michiganensis subsp.... 55 2e-06
CP000026_3589(CP000026|pid:none) Salmonella enterica subsp. ente... 55 2e-06
CP000857_40(CP000857|pid:none) Salmonella enterica subsp. enteri... 55 2e-06
AE017220_36(AE017220|pid:none) Salmonella enterica subsp. enteri... 55 2e-06
CP000416_443(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 55 2e-06
AM920437_2571(AM920437|pid:none) Penicillium chrysogenum Wiscons... 55 2e-06
CP000901_3058(CP000901|pid:none) Yersinia pestis Angola, complet... 55 2e-06
CU695242_39(CU695242|pid:none) Ralstonia solanacearum strain Mol... 55 2e-06
AM933173_42(AM933173|pid:none) Salmonella enterica subsp. enteri... 55 2e-06
CP001144_3983(CP001144|pid:none) Salmonella enterica subsp. ente... 55 2e-06
AE014613_3359(AE014613|pid:none) Salmonella enterica subsp. ente... 55 2e-06
AP007151_663(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 55 2e-06
AM743169_4184(AM743169|pid:none) Stenotrophomonas maltophilia K2... 55 2e-06
AF220438_5(AF220438|pid:none) Salmonella typhimurium putative de... 55 2e-06
AD0507(AD0507) probable glycosyl hydrolase STY0049 [imported] - ... 55 2e-06
CP000588_382(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 55 3e-06
BX640419_187(BX640419|pid:none) Bordetella pertussis strain Toha... 55 3e-06
AK173117_1(AK173117|pid:none) Mus musculus mRNA for mKIAA1161 pr... 55 3e-06
(Q69ZQ1) RecName: Full=Uncharacterized family 31 glucosidase KIA... 55 3e-06
CP000934_2805(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 55 3e-06
AM933172_3791(AM933172|pid:none) Salmonella enterica subsp. ente... 55 3e-06
CP001138_3958(CP001138|pid:none) Salmonella enterica subsp. ente... 55 3e-06
(Q6NSJ0) RecName: Full=Uncharacterized family 31 glucosidase KIA... 55 3e-06
CP000859_1141(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 55 3e-06
AL356494_2(AL356494|pid:none) Human DNA sequence from clone RP11... 55 3e-06
AE006468_41(AE006468|pid:none) Salmonella enterica subsp. enteri... 55 3e-06
BC137640_1(BC137640|pid:none) Mus musculus expressed sequence AI... 55 3e-06
CU914168_1769(CU914168|pid:none) Ralstonia solanacearum strain I... 54 4e-06
CP001113_4007(CP001113|pid:none) Salmonella enterica subsp. ente... 54 4e-06
AM286415_3207(AM286415|pid:none) Yersinia enterocolitica subsp. ... 54 4e-06
AM920431_522(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 54 5e-06
AP006841_1248(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 54 5e-06
CP000605_1315(CP000605|pid:none) Bifidobacterium longum DJO10A, ... 54 5e-06
BX293980_154(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 54 5e-06
AE014295_1157(AE014295|pid:none) Bifidobacterium longum NCC2705,... 54 5e-06
AM238663_1352(AM238663|pid:none) Streptomyces ambofaciens ATCC 2... 54 6e-06
CP000413_501(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 54 6e-06
AM269964_5(AM269964|pid:none) Aspergillus niger contig An01c0170... 54 6e-06
AB161945_3(AB161945|pid:none) Arthrobacter globiformis ctsR, cts... 54 6e-06
AE016830_507(AE016830|pid:none) Enterococcus faecalis V583, comp... 53 8e-06
CP001337_254(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 53 8e-06
CP000886_4825(CP000886|pid:none) Salmonella enterica subsp. ente... 53 8e-06
CP001032_1744(CP001032|pid:none) Opitutus terrae PB90-1, complet... 53 8e-06
CP001107_2512(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 53 8e-06
CP000510_2379(CP000510|pid:none) Psychromonas ingrahamii 37, com... 53 8e-06
(P19965) RecName: Full=SITS-binding protein; AltName: Full=SP105... 53 1e-05
CP000885_214(CP000885|pid:none) Clostridium phytofermentans ISDg... 53 1e-05
CR954204_258(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 53 1e-05
AB073929_3(AB073929|pid:none) Sporosarcina globispora ctsU, ctsV... 53 1e-05
CP000584_240(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 53 1e-05
AM902716_720(AM902716|pid:none) Bordetella petrii strain DSM 128... 53 1e-05
CP000783_4026(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 52 2e-05
CP001013_3199(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 52 2e-05
CP000910_3358(CP000910|pid:none) Renibacterium salmoninarum ATCC... 52 2e-05
AE017198_575(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 52 2e-05
AM420293_4963(AM420293|pid:none) Saccharopolyspora erythraea NRR... 52 2e-05
AL928941_2(AL928941|pid:none) Zebrafish DNA sequence from clone ... 52 2e-05
AE014297_3940(AE014297|pid:none) Drosophila melanogaster chromos... 52 2e-05
CP000423_2617(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 51 3e-05
CP000721_2847(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 51 3e-05
CP000413_108(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 51 4e-05
AM406671_1798(AM406671|pid:none) Lactococcus lactis subsp. cremo... 51 4e-05
CP000356_1650(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 51 4e-05
CU928145_4022(CU928145|pid:none) Escherichia coli 55989 chromoso... 50 5e-05
CP000517_119(CP000517|pid:none) Lactobacillus helveticus DPC 457... 50 5e-05
CR626927_1013(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 50 5e-05
AE005674_3698(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 50 5e-05
CP001113_3770(CP001113|pid:none) Salmonella enterica subsp. ente... 50 5e-05
CP000886_4520(CP000886|pid:none) Salmonella enterica subsp. ente... 50 5e-05
CP000243_4127(CP000243|pid:none) Escherichia coli UTI89, complet... 50 5e-05
CP000036_3462(CP000036|pid:none) Shigella boydii Sb227, complete... 50 5e-05
CU928162_4235(CU928162|pid:none) Escherichia coli ED1a chromosom... 50 5e-05
CP001138_3701(CP001138|pid:none) Salmonella enterica subsp. ente... 50 5e-05
CU928158_3788(CU928158|pid:none) Escherichia fergusonii ATCC 354... 50 5e-05
AM167904_2852(AM167904|pid:none) Bordetella avium 197N complete ... 50 5e-05
AP006841_1145(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 50 5e-05
AP009240_3939(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 50 5e-05
(P31434) RecName: Full=Alpha-xylosidase; EC=3.2.1.-; &... 50 5e-05
AE016823_1087(AE016823|pid:none) Leptospira interrogans serovar ... 50 5e-05
AM933172_3559(AM933172|pid:none) Salmonella enterica subsp. ente... 50 5e-05
CU651637_3545(CU651637|pid:none) Escherichia coli LF82 chromosom... 50 5e-05
CP001127_3682(CP001127|pid:none) Salmonella enterica subsp. ente... 50 5e-05
CR626927_476(CR626927|pid:none) Bacteroides fragilis NCTC 9343, ... 50 7e-05
AE014133_93(AE014133|pid:none) Streptococcus mutans UA159, compl... 50 7e-05
AP006841_551(AP006841|pid:none) Bacteroides fragilis YCH46 DNA, ... 50 7e-05
CP000509_927(CP000509|pid:none) Nocardioides sp. JS614, complete... 50 7e-05
AE014295_1172(AE014295|pid:none) Bifidobacterium longum NCC2705,... 50 9e-05
CP000970_3846(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 50 9e-05
AP009256_1599(AP009256|pid:none) Bifidobacterium adolescentis AT... 49 1e-04
CP000679_1291(CP000679|pid:none) Caldicellulosiruptor saccharoly... 49 1e-04
AB023036_14(AB023036|pid:none) Arabidopsis thaliana genomic DNA,... 49 1e-04
AP006725_4876(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 49 1e-04
AE005174_4567(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 49 2e-04
CR382134_692(CR382134|pid:none) Debaryomyces hansenii strain CBS... 49 2e-04
AE007870_279(AE007870|pid:none) Agrobacterium tumefaciens str. C... 49 2e-04
EU892980_1(EU892980|pid:none) Escherichia coli strain 493/89 hyp... 49 2e-04
AE015928_3168(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 49 2e-04
BT003459_1(BT003459|pid:none) Drosophila melanogaster RH30917 fu... 49 2e-04
CP000246_1272(CP000246|pid:none) Clostridium perfringens ATCC 13... 48 3e-04
CP001330_286(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 48 3e-04
AE014298_807(AE014298|pid:none) Drosophila melanogaster chromoso... 48 3e-04
AE014298_808(AE014298|pid:none) Drosophila melanogaster chromoso... 48 3e-04
AP007159_105(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 48 3e-04
CP000139_209(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 48 3e-04
AE005176_724(AE005176|pid:none) Lactococcus lactis subsp. lactis... 48 3e-04
CP000033_136(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 48 3e-04
AM263198_241(AM263198|pid:none) Listeria welshimeri serovar 6b s... 47 6e-04
AE015928_3657(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 47 8e-04
AE015928_339(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 47 8e-04
CP000077_1077(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 47 8e-04
CP000860_15(CP000860|pid:none) Candidatus Desulforudis audaxviat... 45 0.002
CP001251_299(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 45 0.002
CP000852_1597(CP000852|pid:none) Caldivirga maquilingensis IC-16... 45 0.002
CP001146_46(CP001146|pid:none) Dictyoglomus thermophilum H-6-12,... 45 0.003
CP000382_92(CP000382|pid:none) Clostridium novyi NT, complete ge... 45 0.003
AE014295_170(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 44 0.004
A83888(A83888) hypothetical protein BH1905 [imported] - Bacillus... 44 0.004
BA000016_852(BA000016|pid:none) Clostridium perfringens str. 13 ... 44 0.005
CP000423_394(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 44 0.005
CP000312_2248(CP000312|pid:none) Clostridium perfringens SM101, ... 43 0.009
BA000016_2339(BA000016|pid:none) Clostridium perfringens str. 13... 43 0.009
AP006627_1127(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 43 0.011
CP000360_1952(CP000360|pid:none) Acidobacteria bacterium Ellin34... 42 0.015
CP000393_4066(CP000393|pid:none) Trichodesmium erythraeum IMS101... 42 0.019
AE016830_1706(AE016830|pid:none) Enterococcus faecalis V583, com... 41 0.032
CP000509_2417(CP000509|pid:none) Nocardioides sp. JS614, complet... 40 0.072
AM180088_953(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 40 0.094
AM270409_42(AM270409|pid:none) Aspergillus niger contig An18c017... 39 0.16
CP000009_1295(CP000009|pid:none) Gluconobacter oxydans 621H, com... 38 0.27
AE001437_1072(AE001437|pid:none) Clostridium acetobutylicum ATCC... 38 0.27
EU855809_1(EU855809|pid:none) Taeniopygia guttata sucrase-isomal... 38 0.36
AM233362_1052(AM233362|pid:none) Francisella tularensis subsp. h... 37 0.47
CP000605_1336(CP000605|pid:none) Bifidobacterium longum DJO10A, ... 37 0.80
AM920427_95(AM920427|pid:none) Penicillium chrysogenum Wisconsin... 36 1.0
CP000777_3016(CP000777|pid:none) Leptospira biflexa serovar Pato... 36 1.0
CR954253_190(CR954253|pid:none) Lactobacillus delbrueckii subsp.... 36 1.0
CP000879_1078(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 36 1.4
AC149305_10(AC149305|pid:none) Medicago truncatula clone mth2-78... 36 1.4
AP007157_260(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 35 1.8
CP001402_2650(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 34 4.0
AP006841_1399(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 34 5.2
CR626927_1267(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 34 5.2
CP001400_2526(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 33 6.8
AE006641_297(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 33 8.7
CP001399_2655(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 33 8.8
CP001404_2761(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 33 8.8
>AB000967_1(AB000967|pid:none) Coturnix japonica GAAI mRNA for acid
alpha glucosidase, complete cds.
&AB081289_1(AB081289|pid:none)
Length = 932
Score = 137 bits (344), Expect = 4e-31
Identities = 70/155 (45%), Positives = 97/155 (62%)
Frame = +1
Query: 19 AINGKLTLLPFYYTLFHISHVSGDPVVRPLFFEYPSDPNTFAIDQQFLVGTGLMVSPVLT 198
A+ + +LLPF YTLFH +H+ G+ V RPLFFE+P D T+ +D+QFL G L+V+PVL
Sbjct: 696 ALLTRYSLLPFLYTLFHRAHLQGETVARPLFFEFPWDVATYGLDRQFLWGQSLLVTPVLE 755
Query: 199 QGATTVNAYFPNDIWYEYGNGSLVQSVGTHQTLNAPFDVINVHMRGGNIIPTQPTSSYVT 378
GA +V YFP +WY++ GS V S G L+AP D +N+H+R G+I+PTQ
Sbjct: 756 PGADSVLGYFPQGVWYDFYTGSSVNSSGEMLKLSAPLDHLNLHLREGSILPTQKPG---- 811
Query: 379 PVDGIPITTKISRTLPFELIIALDSSLQATGQLFF 483
IT+K +R P LI+AL + A G LF+
Sbjct: 812 ------ITSKATRGNPLHLIVALSTRATAWGDLFW 840
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,277,320,502
Number of extensions: 28021696
Number of successful extensions: 63428
Number of sequences better than 10.0: 426
Number of HSP's gapped: 63186
Number of HSP's successfully gapped: 445
Length of query: 239
Length of database: 1,051,180,864
Length adjustment: 125
Effective length of query: 114
Effective length of database: 646,610,989
Effective search space: 73713652746
Effective search space used: 73713652746
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |