| Homology vs DNA |
 Query= Contig-U14955-1 (Contig-U14955-1Q) /CSM_Contig/Contig-U14955-1Q.Seq.d (1403 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 1840 0.0 2 (AF304356) Dictyostelium discoideum mitochondrial protein Fs... 1832 0.0 2 (BJ433980) Dictyostelium discoideum cDNA clone:ddv23d18, 3' ... 1108 0.0 1 (BJ361253) Dictyostelium discoideum cDNA clone:ddc16n12, 5' ... 1015 0.0 3 (BJ415730) Dictyostelium discoideum cDNA clone:ddv23d18, 5' ... 1011 0.0 2 (BJ325414) Dictyostelium discoideum cDNA clone:dda14i09, 5' ... 942 0.0 2 (BJ329349) Dictyostelium discoideum cDNA clone:dda24l14, 5' ... 936 0.0 2 (BJ324543) Dictyostelium discoideum cDNA clone:dda6g20, 5' e... 815 0.0 2 (BJ361426) Dictyostelium discoideum cDNA clone:ddc17i01, 5' ... 714 0.0 4 (BJ374827) Dictyostelium discoideum cDNA clone:ddc16n12, 3' ... 793 0.0 2 (BJ428613) Dictyostelium discoideum cDNA clone:ddv12i13, 3' ... 686 0.0 2 (BJ341475) Dictyostelium discoideum cDNA clone:dda6g20, 3' e... 533 0.0 3 (BJ342508) Dictyostelium discoideum cDNA clone:dda14i09, 3' ... 242 7e-90 3 (BJ346672) Dictyostelium discoideum cDNA clone:dda24l14, 3' ... 96 2e-47 4 (AB290193) Bartonella chomelii ftsZ gene for cell division p... 56 7e-14 3 (EU111774) Bartonella rattiaustraliensis strain AUST/NH14 ce... 54 1e-13 4 (EU111773) Bartonella rattiaustraliensis strain AUST/NH10 ce... 54 1e-13 4 (AF067822) Clostridium lentocellum cell division protein (ft... 76 4e-13 2 (AF467765) Bartonella schoenbuchensis cell division protein ... 52 5e-13 4 (EU111771) Bartonella rattiaustraliensis strain AUST/NH4 cel... 62 9e-13 3 (AF467763) Bartonella alsatica cell division protein FtsZ-li... 62 9e-13 3 (AY515134) Bartonella rattimassiliensis strain 16115 FtsZ ge... 52 3e-12 4 (EK449099) 1095467064328 Global-Ocean-Sampling_GS-32-01-01-1... 50 3e-12 4 (EF605286) Bartonella melophagi strain K-2C cell division pr... 56 1e-11 3 (AF467762) Bartonella birtlesii cell division protein FtsZ-l... 56 1e-11 3 (AB290192) Bartonella capreoli ftsZ gene for cell division p... 56 1e-11 3 (EU111775) Bartonella rattiaustraliensis strain AUST/NH18 ce... 54 3e-11 4 (EU111772) Bartonella rattiaustraliensis strain AUST/NH9 cel... 54 3e-11 4 (EJ063816) 1095458017892 Global-Ocean-Sampling_GS-26-01-01-1... 52 9e-11 2 (EJ599798) 1092961131154 Global-Ocean-Sampling_GS-29-01-01-1... 50 3e-10 3 (AY515133) Bartonella rattimassiliensis strain 15908 FtsZ ge... 44 5e-10 4 (AJ010273) Wolbachia endosymbiont of Dirofilaria repens part... 58 5e-09 2 (AY774132) Synthetic construct Francisella tularensis clone ... 72 6e-08 1 (U76309) Francisella tularensis cell division proteins FtsA ... 72 6e-08 1 (CP000915) Francisella tularensis subsp. mediasiatica FSC147... 72 6e-08 1 (CP000803) Francisella tularensis subsp. holarctica FTNF002-... 72 6e-08 1 (CP000608) Francisella tularensis subsp. tularensis WY96-341... 72 6e-08 1 (CP000439) Francisella tularensis subsp. novicida U112, comp... 72 6e-08 1 (CP000437) Francisella tularensis subsp. holarctica OSU18, c... 72 6e-08 1 (AM286280) Francisella tularensis subsp. tularensis strain F... 72 6e-08 1 (AM233362) Francisella tularensis subsp. holarctica LVS comp... 72 6e-08 1 (AJ749949) Francisella tularensis subsp. tularensis SCHU S4 ... 72 6e-08 1 (AJ010266) Wolbachia endosymbiont of Onchocerca gutturosa pa... 54 8e-08 2 (DQ907344) Vibrio fischeri strain LMG4144 FtsZ (ftsZ) gene, ... 52 1e-07 3 (EJ351009) 1092963588462 Global-Ocean-Sampling_GS-28-01-01-1... 38 2e-07 4 (EJ267848) 1095351027184 Global-Ocean-Sampling_GS-27-01-01-1... 40 2e-07 4 (AF282845) Wolbachia endosymbiont of Onchocerca volvulus cel... 52 3e-07 2 (AJ010268) Wolbachia endosymbiont of Onchocerca ochengi part... 52 3e-07 2 (AJ010267) Wolbachia endosymbiont of Onchocerca gibsoni part... 52 3e-07 2 (DQ647002) Ehrlichia ruminantium strain Kumm2 cell division ... 40 3e-07 5 (EK524927) 1095515638268 Global-Ocean-Sampling_GS-32-01-01-1... 38 3e-07 4 (EJ540117) 1092955361098 Global-Ocean-Sampling_GS-29-01-01-1... 50 5e-07 2 (EJ592602) 1092961059634 Global-Ocean-Sampling_GS-29-01-01-1... 50 6e-07 2 (CP000083) Colwellia psychrerythraea 34H, complete genome. 52 8e-07 2 (CP000388) Pseudoalteromonas atlantica T6c, complete genome. 68 1e-06 1 (AF467761) Bartonella weissi cell division protein FtsZ-like... 52 1e-06 2 (EG726101) GTE00008393 Guillardia theta non-normalised Guill... 46 1e-06 2 (EJ663072) 1092955031688 Global-Ocean-Sampling_GS-30-02-01-1... 50 2e-06 3 (EJ381722) 1092963764333 Global-Ocean-Sampling_GS-28-01-01-1... 52 2e-06 2 (EJ418440) 1093012206652 Global-Ocean-Sampling_GS-28-01-01-1... 52 2e-06 2 (EJ649843) 1092953007229 Global-Ocean-Sampling_GS-30-02-01-1... 50 2e-06 3 (EU111781) Bartonella coopersplainensis strain AUST/NH20 cel... 40 3e-06 4 (AJ007748) Guillardia theta ftsZ gene. 46 3e-06 2 (AY390278) Ehrlichia ruminantium cell division protein (ftsZ... 38 3e-06 4 (DQ647001) Ehrlichia ruminantium strain Sankat cell division... 38 3e-06 4 (DQ647000) Ehrlichia ruminantium strain Pokoase cell divisio... 38 3e-06 4 (DQ646999) Ehrlichia ruminantium strain Kumm1 cell division ... 38 3e-06 4 (DQ646998) Ehrlichia ruminantium strain Senegal cell divisio... 38 3e-06 4 (EF596704) Vibrio rotiferianus strain R-646 cell division pr... 66 4e-06 1 (ER312802) 1092343806312 Global-Ocean-Sampling_GS-34-01-01-1... 44 4e-06 2 (DQ907346) Vibrio fortis strain LMG21557 FtsZ (ftsZ) gene, p... 52 5e-06 3 (DQ481635) Vibrio splendidus strain LMG19031 FtsZ (ftsZ) gen... 60 5e-06 2 (DQ981853) Vibrio kanaloae strain R15012 cell division prote... 60 6e-06 2 (DQ481631) Vibrio kanaloae strain LMG20539 FtsZ (ftsZ) gene,... 60 6e-06 2 (DQ481632) Vibrio kanaloae strain R15010 FtsZ (ftsZ) gene, p... 60 6e-06 2 (AF467754) Bartonella doshiae cell division protein FtsZ-lik... 50 7e-06 3 (AF522273) Bartonella sp. BNfRs cell division protein FtsZ g... 44 8e-06 3 (EK344317) 1095467192076 Global-Ocean-Sampling_GS-31-01-01-1... 64 2e-05 1 (DQ481624) Vibrio crassostreae strain LMG22240 FtsZ (ftsZ) g... 52 2e-05 3 (DQ907334) Listonella anguillarum strain LMG4437 FtsZ (ftsZ)... 62 2e-05 2 (DQ907372) Vibrio rotiferianus strain LMG21460 FtsZ (ftsZ) g... 60 2e-05 2 (EJ270903) 1095353014318 Global-Ocean-Sampling_GS-27-01-01-1... 40 3e-05 3 (EJ344369) 1092963537398 Global-Ocean-Sampling_GS-28-01-01-1... 38 3e-05 4 (EK311080) 1095462397159 Global-Ocean-Sampling_GS-31-01-01-1... 44 4e-05 3 (AY056331) Arabidopsis thaliana putative plastid division pr... 50 6e-05 2 (AY150504) Arabidopsis thaliana putative plastid division pr... 50 6e-05 2 (AF384167) Arabidopsis thaliana plastid division protein Fts... 50 6e-05 2 (DQ907335) Vibrio brasiliensis strain LMG20546 FtsZ (ftsZ) g... 62 6e-05 1 (CP000419) Streptococcus thermophilus LMD-9, complete genome. 62 6e-05 1 (CP000024) Streptococcus thermophilus CNRZ1066, complete gen... 62 6e-05 1 (CP000023) Streptococcus thermophilus LMG 18311, complete ge... 62 6e-05 1 (EK360506) 1095468941328 Global-Ocean-Sampling_GS-31-01-01-1... 52 6e-05 2 (DQ907355) Vibrio logei strain LMG14011 FtsZ (ftsZ) gene, pa... 60 9e-05 2 (EJ170063) 1092344080186 Global-Ocean-Sampling_GS-27-01-01-1... 44 1e-04 3 (AF467755) Bartonella koehlerae cell division protein FtsZ-l... 36 1e-04 4 (EJ489907) 1095403530809 Global-Ocean-Sampling_GS-28-01-01-1... 38 2e-04 4 (DJ372126) Identification of Essential Genes in Prokaryotes. 32 2e-04 4 (DJ372125) Identification of Essential Genes in Prokaryotes. 32 2e-04 4 (DJ371798) Identification of Essential Genes in Prokaryotes. 32 2e-04 4 (EF596703) Vibrio rotiferianus strain LMG 21460 cell divisio... 60 2e-04 1
>(AC115612) Dictyostelium discoideum chromosome 2 map 6245135-6357017 strain AX4, complete sequence. Length = 111882
Score = 1840 bits (928), Expect(2) = 0.0 Identities = 940/946 (99%) Strand = Plus / Plus
Query: 134 atgatgattcaaattggatatcaacaccaaatattacagtatgtggtattggtggtggtg 193 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93359 atgatgattcaaattggatatcaacaccaaatattacagtatgtggtattggtggtggtg 93418
Query: 194 gttgtaatagtgttaataatatgattaataaagaattatatggaattgattttgtagttg 253 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93419 gttgtaatagtgttaataatatgattaataaagaattatatggaattgattttgtagttg 93478
Query: 254 ccaatactgatgcacaagcattggcaatatcatgtagtagaaagatggtacaattaggaa 313 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93479 ccaatactgatgcacaagcattggcaatatcatgtagtagaaagatggtacaattaggaa 93538
Query: 314 agacattaacaagaggattaggagcaggagcagtaccagaagttggaaagaaagcaactg 373 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93539 agacattaacaagaggattaggagcaggagcagtaccagaagttggaaagaaagcaactg 93598
Query: 374 aagaatcaattgaagaattaatgaatcaaattggtgatacacaaatgttatttgtcacag 433 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93599 aagaatcaattgaagaattaatgaatcaaattggtgatacacaaatgttatttgtcacag 93658
Query: 434 ctggtatgggtggtggtacaggtacaggtggagcagcagttattgcatcagcagcaaaag 493 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93659 ctggtatgggtggtggtacaggtacaggtggagcagcagttattgcatcagcagcaaaag 93718
Query: 494 ccaaaggtattttaactgttggtattgtaaccaaaccatttcatttcgaaggtaaacata 553 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93719 ccaaaggtattttaactgttggtattgtaaccaaaccatttcatttcgaaggtaaacata 93778
Query: 554 gaatgaaattggcagaacaaggtttgatagagttggagaaatcagtcgatagtttaatcg 613 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93779 gaatgaaattggcagaacaaggtttgatagagttggagaaatcagtcgatagtttaatcg 93838
Query: 614 ttattccaaatgagaaattaatggaacaatcacaagaactctatattggaaatgctttcc 673 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93839 ttattccaaatgagaaattaatggaacaatcacaagaactctatattggaaatgctttcc 93898
Query: 674 aaatggttgatgatgtactttacaatagtattcgtggtatctctgatattttagttaaac 733 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93899 aaatggttgatgatgtactttacaatagtattcgtggtatctctgatattttagttaaac 93958
Query: 734 caggtttaattaatttagatttcgccgatgttagatcgatcatgtgtaatagtggtaaag 793 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 93959 caggtttaattaatttagatttcgccgatgttagatcgatcatgtgtaatagtggtaaag 94018
Query: 794 cattgatgggtgttggagaaggtgaaggtaaaggtcgtgatgctatcgcagccaatatag 853 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 94019 cattgatgggtgttggagaaggtgaaggtaaaggtcgtgatgctatcgcagccaatatag 94078
Query: 854 ccttaaataatccattactngagaatattaatatntntggtgcaaaaggtgtccttttaa 913 ||||||||||||||||||| |||||||||||||| | ||||||||||||||||||||||| Sbjct: 94079 ccttaaataatccattactcgagaatattaatatctctggtgcaaaaggtgtccttttaa 94138
Query: 914 atattgntggtagtgacttaaaattacaagaagttgatcatatcgttagtttggttagta 973 |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 94139 atattgctggtagtgacttaaaattacaagaagttgatcatatcgttagtttggttagta 94198
Query: 974 gtaaagttgatccttctgntaatatcatctttggttcaacttttgatcaacaattagaag 1033 |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| Sbjct: 94199 gtaaagttgatccttctgctaatatcatctttggttcaacttttgatcaacaattagaag 94258
Query: 1034 gtanaattagagtaactttaattgttaccggtatggatcaattaat 1079 ||| |||||||||||||||||||||||||||||||||||||||||| Sbjct: 94259 gtaaaattagagtaactttaattgttaccggtatggatcaattaat 94304
Score = 32.2 bits (16), Expect(2) = 0.0 Identities = 16/16 (100%) Strand = Plus / Plus
Query: 81 ttttattaaaagatat 96 |||||||||||||||| Sbjct: 93306 ttttattaaaagatat 93321
Score = 95.6 bits (48), Expect(4) = 2e-38 Identities = 48/48 (100%) Strand = Plus / Plus
Query: 1155 tgtagatcaagaattaaaaccaattgaaccacaaaaatcaataattat 1202 |||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 94380 tgtagatcaagaattaaaaccaattgaaccacaaaaatcaataattat 94427
Score = 73.8 bits (37), Expect(4) = 2e-38 Identities = 37/37 (100%) Strand = Plus / Plus
Query: 1284 taagttttttgaaaagattatcaaaccttttctttac 1320 ||||||||||||||||||||||||||||||||||||| Sbjct: 94688 taagttttttgaaaagattatcaaaccttttctttac 94724
Score = 60.0 bits (30), Expect(4) = 2e-38 Identities = 30/30 (100%) Strand = Plus / Plus
Query: 51 aaaggttttcaattcaccaaaatcattaaa 80 |||||||||||||||||||||||||||||| Sbjct: 93195 aaaggttttcaattcaccaaaatcattaaa 93224
Score = 38.2 bits (19), Expect(4) = 2e-38 Identities = 19/19 (100%) Strand = Plus / Plus
Query: 35 aaattataaacctttcaaa 53 ||||||||||||||||||| Sbjct: 93178 aaattataaacctttcaaa 93196
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,318,600,715 Number of extensions: 80516457 Number of successful extensions: 7339435 Number of sequences better than 10.0: 719 Length of query: 1403 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1379 Effective length of database: 97,308,875,965 Effective search space: 134188939955735 Effective search space used: 134188939955735 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
| Homology vs Protein |
 Query= Contig-U14955-1 (Contig-U14955-1Q) /CSM_Contig/Contig-U14955-1Q.Seq.d (1403 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54Z54) RecName: Full=Mitochondrial division protein fszA; 588 e-166 AC115612_43(AC115612|pid:none) Dictyostelium discoideum chromoso... 543 e-153 CP000236_1102(CP000236|pid:none) Ehrlichia chaffeensis str. Arka... 283 1e-74 AF221944_1(AF221944|pid:none) Ehrlichia chaffeensis cell divisio... 283 1e-74 CP000107_905(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 283 1e-74 DQ646992_1(DQ646992|pid:none) Ehrlichia ruminantium strain Mara8... 282 2e-74 AY390278_1(AY390278|pid:none) Ehrlichia ruminantium cell divisio... 282 2e-74 CR767821_907(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 282 2e-74 DQ646994_1(DQ646994|pid:none) Ehrlichia ruminantium strain Kiswa... 282 2e-74 DQ646997_1(DQ646997|pid:none) Ehrlichia ruminantium strain Blaau... 280 9e-74 DQ647002_1(DQ647002|pid:none) Ehrlichia ruminantium strain Kumm2... 278 3e-73 CP000758_1734(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 278 3e-73 CP000030_877(CP000030|pid:none) Anaplasma marginale str. St. Mar... 278 4e-73 CP000708_1269(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 276 2e-72 CP001488_1361(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 276 2e-72 AC3325(AC3325) cell division protein ftsZ [imported] - Brucella ... 276 2e-72 AP007255_3854(AP007255|pid:none) Magnetospirillum magneticum AMB... 275 3e-72 CP000628_2244(CP000628|pid:none) Agrobacterium radiobacter K84 c... 275 4e-72 AE007869_2037(AE007869|pid:none) Agrobacterium tumefaciens str. ... 274 5e-72 AM690313_1(AM690313|pid:none) Bartonella birtlesii partial ftsZ ... 274 6e-72 CP001074_2950(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 274 6e-72 AM260525_1419(AM260525|pid:none) Bartonella tribocorum CIP 10547... 273 1e-71 CP001562_1216(CP001562|pid:none) Bartonella grahamii as4aup, com... 273 1e-71 (P30327) RecName: Full=Cell division protein ftsZ homolog 1; &A... 273 1e-71 AF141018_1(AF141018|pid:none) Bartonella clarridgeiae cell divis... 272 2e-71 CP000390_1989(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 271 5e-71 BA000012_1214(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 270 7e-71 CP000449_2066(CP000449|pid:none) Maricaulis maris MCS10, complet... 270 7e-71 CP000377_689(CP000377|pid:none) Silicibacter sp. TM1040, complet... 270 9e-71 CP001389_2060(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 269 2e-70 CP000490_1635(CP000490|pid:none) Paracoccus denitrificans PD1222... 268 4e-70 AY515135_1(AY515135|pid:none) Bartonella phoceensis strain 16120... 267 6e-70 CP001227_774(CP001227|pid:none) Rickettsia peacockii str. Rustic... 267 8e-70 AF221946_1(AF221946|pid:none) Rickettsia rickettsii cell divisio... 267 8e-70 (P52976) RecName: Full=Cell division protein ftsZ; &AE005673_25... 266 1e-69 AM999887_576(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 266 1e-69 FJ667579_1(FJ667579|pid:none) Bartonella sp. KM2563 cell divisio... 266 2e-69 CP000766_1046(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 265 2e-69 CP000774_2413(CP000774|pid:none) Parvibaculum lavamentivorans DS... 265 2e-69 FJ667581_1(FJ667581|pid:none) Bartonella sp. TT0105 cell divisio... 265 3e-69 DQ825692_1(DQ825692|pid:none) Bartonella washoensis subsp. cynom... 265 4e-69 DQ825696_1(DQ825696|pid:none) Bartonella sp. CL10406co cell divi... 265 4e-69 CP000927_3646(CP000927|pid:none) Caulobacter sp. K31, complete g... 264 5e-69 U40273_1(U40273|pid:none) Caulobacter crescentus cell division i... 264 5e-69 CP000409_853(CP000409|pid:none) Rickettsia canadensis str. McKie... 264 5e-69 AP009384_4564(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 263 1e-68 CP000847_946(CP000847|pid:none) Rickettsia akari str. Hartford, ... 263 1e-68 (Q68W73) RecName: Full=Cell division protein ftsZ; &AE017197_62... 263 1e-68 AJ495000_1(AJ495000|pid:none) Wolbachia endosymbiont of Dirofila... 262 3e-68 DQ825693_1(DQ825693|pid:none) Bartonella sp. CL6416co cell divis... 262 3e-68 CP000661_694(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 260 1e-67 CP001280_3399(CP001280|pid:none) Methylocella silvestris BL2, co... 259 1e-67 CP000394_423(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 259 2e-67 CP000143_701(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 259 2e-67 AB478515_19(AB478515|pid:none) Wolbachia endosymbiont of Cadra c... 259 2e-67 CP000248_1135(CP000248|pid:none) Novosphingobium aromaticivorans... 258 3e-67 CP000830_2401(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 258 5e-67 AP007255_1015(AP007255|pid:none) Magnetospirillum magneticum AMB... 258 5e-67 CP000115_1052(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 257 8e-67 CP000463_2099(CP000463|pid:none) Rhodopseudomonas palustris BisA... 256 1e-66 EU833483_2(EU833483|pid:none) Wolbachia symbiont of Radopholus s... 256 2e-66 BA000040_6596(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 255 3e-66 CP000319_1209(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 255 3e-66 CP000283_3370(CP000283|pid:none) Rhodopseudomonas palustris BisB... 254 4e-66 CP000943_6360(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 254 5e-66 CP001096_3973(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 254 7e-66 EF682092_1(EF682092|pid:none) Candidatus Bartonella rudakovii is... 253 9e-66 CP000699_3912(CP000699|pid:none) Sphingomonas wittichii RW1, com... 253 2e-65 CP000908_2909(CP000908|pid:none) Methylobacterium extorquens PA1... 252 3e-65 CP001029_3089(CP001029|pid:none) Methylobacterium populi BJ001, ... 252 3e-65 AF179611_14(AF179611|pid:none) Zymomonas mobilis ZM4 fosmid clon... 251 4e-65 CP000356_1861(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 251 6e-65 CP000697_69(CP000697|pid:none) Acidiphilium cryptum JF-5, comple... 250 1e-64 EU571942_1(EU571942|pid:none) Bartonella clarridgeiae strain M9H... 249 2e-64 CP000157_365(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 247 6e-64 AF076530_2(AF076530|pid:none) Synechococcus PCC7942 cell divisio... 246 1e-63 CP000133_2801(CP000133|pid:none) Rhizobium etli CFN 42, complete... 246 1e-63 CP000009_158(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 246 2e-63 AF120116_1(AF120116|pid:none) Mallomonas splendens FtsZ (MsFtsZ-... 246 2e-63 CP000629_1316(CP000629|pid:none) Agrobacterium radiobacter K84 c... 244 4e-63 AX492992_1(AX492992|pid:none) Sequence 9 from Patent WO02059613. 244 5e-63 CP000095_1676(CP000095|pid:none) Prochlorococcus marinus str. NA... 243 9e-63 CP000633_97(CP000633|pid:none) Agrobacterium vitis S4 chromosome... 243 9e-63 AP008230_2902(AP008230|pid:none) Desulfitobacterium hafniense Y5... 243 9e-63 AJ011025_2(AJ011025|pid:none) Prochlorococcus sp. ftsZ gene and ... 243 1e-62 (P45484) RecName: Full=Cell division protein ftsZ homolog 2; &A... 243 1e-62 CP000232_826(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 243 2e-62 CP000551_1504(CP000551|pid:none) Prochlorococcus marinus str. AS... 242 2e-62 CP000576_1496(CP000576|pid:none) Prochlorococcus marinus str. MI... 242 2e-62 CT978603_600(CT978603|pid:none) Synechococcus sp. RCC307 genomic... 242 2e-62 CP000612_671(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 241 4e-62 AF522273_1(AF522273|pid:none) Bartonella sp. BNfRs cell division... 241 4e-62 CP000240_2053(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 241 4e-62 CP000825_1533(CP000825|pid:none) Prochlorococcus marinus str. MI... 241 6e-62 AM236080_3072(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 241 6e-62 CP000629_1208(CP000629|pid:none) Agrobacterium radiobacter K84 c... 241 6e-62 AB032071_1(AB032071|pid:none) Cyanidioschyzon merolae CmftsZ1 ge... 241 6e-62 CP000111_1527(CP000111|pid:none) Prochlorococcus marinus str. MI... 240 8e-62 CP001191_2257(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 240 8e-62 BX548175_392(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 239 1e-61 CP000239_106(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp... 239 2e-61 CP001389_1907(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 239 2e-61 CP000930_1996(CP000930|pid:none) Heliobacterium modesticaldum Ic... 239 2e-61 BA000045_298(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 238 3e-61 L25440_1(L25440|pid:none) Rhizobium meliloti ftsZ gene, complete... 238 4e-61 CP000133_2588(CP000133|pid:none) Rhizobium etli CFN 42, complete... 238 4e-61 CP001074_2713(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 238 5e-61 AE017126_1380(AE017126|pid:none) Prochlorococcus marinus subsp. ... 237 7e-61 FP312973_17(FP312973|pid:none) uncultured bacterial clone 0904b6... 237 9e-61 AM778941_36(AM778941|pid:none) Microcystis aeruginosa PCC 7806 g... 236 1e-60 CP000806_1312(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 236 1e-60 CP000312_1699(CP000312|pid:none) Clostridium perfringens SM101, ... 236 1e-60 CP000853_1359(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 236 1e-60 AP009389_1850(AP009389|pid:none) Pelotomaculum thermopropionicum... 235 3e-60 AP009552_2642(AP009552|pid:none) Microcystis aeruginosa NIES-843... 235 3e-60 AP006840_1219(AP006840|pid:none) Symbiobacterium thermophilum IA... 234 6e-60 JC4289(JC4289) cell division protein ftsZ - Anabaena sp. (PCC 71... 234 6e-60 (P45482) RecName: Full=Cell division protein ftsZ; &AC2288(AC22... 234 6e-60 AE017194_3918(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 234 7e-60 AE017355_3608(AE017355|pid:none) Bacillus thuringiensis serovar ... 234 7e-60 EF605281_1(EF605281|pid:none) Bartonella tamiae strain Th307 cel... 234 7e-60 CP001344_4444(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 234 7e-60 CP000110_832(CP000110|pid:none) Synechococcus sp. CC9605, comple... 234 7e-60 CP000568_441(CP000568|pid:none) Clostridium thermocellum ATCC 27... 233 1e-59 CP000435_709(CP000435|pid:none) Synechococcus sp. CC9311, comple... 233 1e-59 CP001037_4350(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 233 1e-59 AY508998_1(AY508998|pid:none) Wolbachia endosymbiont of Drosophi... 232 2e-59 CP000924_803(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 232 2e-59 CP000112_1047(CP000112|pid:none) Desulfovibrio desulfuricans G20... 232 3e-59 CP000878_1358(CP000878|pid:none) Prochlorococcus marinus str. MI... 232 3e-59 EF605282_1(EF605282|pid:none) Bartonella tamiae strain Th339 cel... 232 3e-59 CP000448_794(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 232 3e-59 CP001034_1292(CP001034|pid:none) Natranaerobius thermophilus JW/... 232 3e-59 CP000382_1364(CP000382|pid:none) Clostridium novyi NT, complete ... 232 3e-59 CP000860_1366(CP000860|pid:none) Candidatus Desulforudis audaxvi... 231 5e-59 CP000097_1528(CP000097|pid:none) Synechococcus sp. CC9902, compl... 231 6e-59 AE000516_2272(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 230 8e-59 BA000039_2381(BA000039|pid:none) Thermosynechococcus elongatus B... 230 8e-59 AE015927_985(AE015927|pid:none) Clostridium tetani E88, complete... 230 8e-59 (P64170) RecName: Full=Cell division protein ftsZ; &(P64171) Re... 230 8e-59 AM420293_5664(AM420293|pid:none) Saccharopolyspora erythraea NRR... 230 1e-58 AB091102_1(AB091102|pid:none) Marchantia polymorpha gene for fts... 230 1e-58 AM180552_1(AM180552|pid:none) Wolbachia endosymbiont of Dactylop... 230 1e-58 AP006627_2345(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 229 2e-58 CP000724_2780(CP000724|pid:none) Alkaliphilus metalliredigens QY... 229 2e-58 CP000962_2516(CP000962|pid:none) Clostridium botulinum A3 str. L... 229 2e-58 AM746676_1670(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 229 2e-58 AF232235_1(AF232235|pid:none) Wolbachia endosymbiont of Nephila ... 228 3e-58 BT040272_1(BT040272|pid:none) Zea mays full-length cDNA clone ZM... 228 3e-58 CP001287_4070(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 228 3e-58 AF220605_1(AF220605|pid:none) Wolbachia sp. cell-cycle protein F... 228 3e-58 CP000360_3447(CP000360|pid:none) Acidobacteria bacterium Ellin34... 228 3e-58 AB107224_1(AB107224|pid:none) Wolbachia endosymbiont of Eurema h... 228 4e-58 AF081199_1(AF081199|pid:none) Wolbachia sp. 'Litomosides sigmodo... 228 5e-58 CP000560_1427(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 228 5e-58 CP000325_2873(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 227 7e-58 CP000804_1047(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 227 7e-58 CP000750_3168(CP000750|pid:none) Kineococcus radiotolerans SRS30... 227 9e-58 AH1328(AH1328) cell-division initiation protein FtsZ homolog fts... 227 9e-58 AY157007_1(AY157007|pid:none) Wolbachia endosymbiont of Anastrep... 227 9e-58 CP000250_2166(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 227 9e-58 AM263198_2046(AM263198|pid:none) Listeria welshimeri serovar 6b ... 227 9e-58 CP001175_520(CP001175|pid:none) Listeria monocytogenes HCC23, co... 227 9e-58 BA000028_1473(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 227 9e-58 AH1699(AH1699) cell-division initiation protein FtsZ homolog fts... 227 9e-58 BA000030_6130(BA000030|pid:none) Streptomyces avermitilis MA-468... 226 1e-57 AY136551_1(AY136551|pid:none) Wolbachia endosymbiont of Diabroti... 226 1e-57 AP009493_5423(AP009493|pid:none) Streptomyces griseus subsp. gri... 226 1e-57 (P45500) RecName: Full=Cell division protein ftsZ; &AL939111_11... 226 1e-57 CP001091_23(CP001091|pid:none) Actinobacillus pleuropneumoniae s... 226 1e-57 AF073487_1(AF073487|pid:none) Streptomyces collinus cell divisio... 226 1e-57 CP000384_3238(CP000384|pid:none) Mycobacterium sp. MCS, complete... 226 1e-57 (P45501) RecName: Full=Cell division protein ftsZ; &U07344_2(U0... 226 1e-57 AP009049_1235(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 226 1e-57 (Q9CCE4) RecName: Full=Cell division protein ftsZ; &AL583920_76... 226 2e-57 (Q9K9T7) RecName: Full=Cell division protein ftsZ; &BA000004_25... 226 2e-57 CP000481_1009(CP000481|pid:none) Acidothermus cellulolyticus 11B... 226 2e-57 AJ010274_1(AJ010274|pid:none) Anaplasma marginale ftsZ gene, par... 226 2e-57 U95752_1(U95752|pid:none) Wolbachia sp. MB35 cell division prote... 226 2e-57 CP000480_4077(CP000480|pid:none) Mycobacterium smegmatis str. MC... 226 2e-57 CP001131_3802(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 225 3e-57 CP000511_3464(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 225 3e-57 CP000656_2972(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 225 3e-57 AP006618_1779(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 225 3e-57 CP000769_3853(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 225 3e-57 AP008955_3829(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 225 3e-57 AE016958_1894(AE016958|pid:none) Mycobacterium avium subsp. para... 225 3e-57 CP000113_5450(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 224 4e-57 EU111781_1(EU111781|pid:none) Bartonella coopersplainsensis stra... 224 4e-57 AF067823_1(AF067823|pid:none) Clostridium propionicum cell divis... 224 4e-57 AF384167_1(AF384167|pid:none) Arabidopsis thaliana plastid divis... 224 4e-57 T06774(T06774) cell division protein, chloroplast - garden pea ... 224 4e-57 CP001022_1922(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 224 6e-57 CP000686_3705(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 224 6e-57 AP008957_3549(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 224 6e-57 CP000251_3766(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 224 6e-57 AE017333_1650(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 224 8e-57 AM180355_2718(AM180355|pid:none) Clostridium difficile 630 compl... 224 8e-57 CP000431_1076(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 224 8e-57 CP000027_335(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 223 1e-56 CP001321_117(CP001321|pid:none) Haemophilus parasuis SH0165, com... 223 1e-56 CP001638_946(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 223 1e-56 CP001132_371(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 223 1e-56 CP001398_484(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 223 1e-56 EF612436_1(EF612436|pid:none) Bacillus subtilis strain ATCC 6633... 223 1e-56 AB440637_1(AB440637|pid:none) Bartonella sp. Fuji 23-1 ftsZ gene... 223 1e-56 AL935258_115(AL935258|pid:none) Lactobacillus plantarum strain W... 223 1e-56 AF467754_1(AF467754|pid:none) Bartonella doshiae cell division p... 223 1e-56 AB440633_1(AB440633|pid:none) Bartonella sp. Fuji 18-1 ftsZ gene... 223 1e-56 (Q9KH25) RecName: Full=Cell division protein ftsZ; &AF273451_1(... 223 1e-56 EU111771_1(EU111771|pid:none) Bartonella rattaustraliani strain ... 223 1e-56 CP001615_2819(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 223 1e-56 CP000922_1800(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 223 2e-56 BX842654_293(BX842654|pid:none) Bdellovibrio bacteriovorus compl... 223 2e-56 AF205858_1(AF205858|pid:none) Nicotiana tabacum FtsZ-like protei... 223 2e-56 CP000088_1111(CP000088|pid:none) Thermobifida fusca YX, complete... 223 2e-56 AE017283_752(AE017283|pid:none) Propionibacterium acnes KPA17120... 223 2e-56 AP009153_1439(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 222 2e-56 CP001337_2768(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 222 2e-56 (P94337) RecName: Full=Cell division protein ftsZ; &BA000036_21... 222 2e-56 AB242290_1(AB242290|pid:none) Bartonella sp. Fuji 12-1 ftsZ gene... 222 2e-56 AJ001586_1(AJ001586|pid:none) Physcomitrella patens mRNA for pla... 222 2e-56 AE014184_515(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 222 2e-56 CP001197_944(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 222 2e-56 AB292598_1(AB292598|pid:none) Bartonella washoensis ftsZ gene fo... 222 3e-56 AY056331_1(AY056331|pid:none) Arabidopsis thaliana putative plas... 222 3e-56 AF467753_1(AF467753|pid:none) Bartonella grahamii cell division ... 222 3e-56 AB292602_1(AB292602|pid:none) Bartonella bacilliformis ftsZ gene... 222 3e-56 BA000035_2048(BA000035|pid:none) Corynebacterium efficiens YS-31... 222 3e-56 CT573213_2137(CT573213|pid:none) Frankia alni str. ACN14A chromo... 221 4e-56 AM849034_1361(AM849034|pid:none) Clavibacter michiganensis subsp... 221 4e-56 CP000777_306(CP000777|pid:none) Leptospira biflexa serovar Patoc... 221 4e-56 CP000820_4984(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 221 4e-56 AB426638_1(AB426638|pid:none) Bartonella grahamii ftsZ gene for ... 221 4e-56 CP000249_1400(CP000249|pid:none) Frankia sp. CcI3, complete geno... 221 4e-56 AE016822_1221(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 221 4e-56 AP010904_3322(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 221 4e-56 CP001390_770(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 221 4e-56 CP000667_3159(CP000667|pid:none) Salinispora tropica CNB-440, co... 221 4e-56 AM711867_1876(AM711867|pid:none) Clavibacter michiganensis subsp... 221 4e-56 AJ875090_1(AJ875090|pid:none) Medicago truncatula mRNA for plast... 221 4e-56 AE017285_2486(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 221 4e-56 AX751477_1(AX751477|pid:none) Sequence 11 from Patent WO03035874. 221 5e-56 DQ676486_1(DQ676486|pid:none) Bartonella rochalimae Humboldt 131... 221 5e-56 AJ271200_1(AJ271200|pid:none) Wolbachia sp. partial ftsZ gene fo... 221 5e-56 AF467757_1(AF467757|pid:none) Bartonella vinsonii subsp. vinsoni... 221 5e-56 AE017143_692(AE017143|pid:none) Haemophilus ducreyi strain 35000... 221 5e-56 CP001628_1287(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 221 6e-56 AB290192_1(AB290192|pid:none) Bartonella capreoli ftsZ gene for ... 221 6e-56 CP000482_3234(CP000482|pid:none) Pelobacter propionicus DSM 2379... 220 8e-56 Y08964_3(Y08964|pid:none) Brevibacterium lactofermentum murC(par... 220 8e-56 CP001348_2022(CP001348|pid:none) Clostridium cellulolyticum H10,... 220 1e-55 AF067822_1(AF067822|pid:none) Clostridium lentocellum cell divis... 220 1e-55 AB426650_1(AB426650|pid:none) Bartonella grahamii ftsZ gene for ... 219 1e-55 AF467763_1(AF467763|pid:none) Bartonella alsatica cell division ... 219 2e-55 AF467756_1(AF467756|pid:none) Bartonella taylorii cell division ... 219 2e-55 CP000910_2457(CP000910|pid:none) Renibacterium salmoninarum ATCC... 219 2e-55 AF467761_1(AF467761|pid:none) Bartonella weissi cell division pr... 219 2e-55 CP000411_1034(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 219 2e-55 CP000698_3894(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 219 2e-55 AJ271201_1(AJ271201|pid:none) Wolbachia sp. partial ftsZ gene fo... 219 2e-55 CP000544_2054(CP000544|pid:none) Halorhodospira halophila SL1, c... 219 2e-55 AJ271203_1(AJ271203|pid:none) Wolbachia sp. partial ftsZ gene fo... 218 3e-55 (P45499) RecName: Full=Cell division protein ftsZ; &AP009152_14... 218 3e-55 CP000557_981(CP000557|pid:none) Geobacillus thermodenitrificans ... 218 3e-55 CP001341_1559(CP001341|pid:none) Arthrobacter chlorophenolicus A... 218 3e-55 CP000859_2775(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 218 4e-55 AB045315_1(AB045315|pid:none) Wolbachia sp. wVes ftsZ gene for c... 218 5e-55 CP001056_1121(CP001056|pid:none) Clostridium botulinum B str. Ek... 218 5e-55 AB426647_1(AB426647|pid:none) Bartonella grahamii ftsZ gene for ... 218 5e-55 CP000721_1110(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 217 7e-55 DQ155377_1(DQ155377|pid:none) Uncultured Bartonella sp. cell div... 217 7e-55 AY566426_1(AY566426|pid:none) Wolbachia pipientis strain wCalt1 ... 217 7e-55 AB091103_1(AB091103|pid:none) Marchantia polymorpha gene for fts... 217 7e-55 AB037894_1(AB037894|pid:none) Wolbachia sp. wMic ftsZ gene for c... 217 7e-55 AB039038_1(AB039038|pid:none) Wolbachia sp. wStri ftsZ gene for ... 217 7e-55 AB167352_1(AB167352|pid:none) Wolbachia endosymbiont of Hypolimn... 217 7e-55 AB039280_1(AB039280|pid:none) Wolbachia sp. wDry gene for cell d... 217 9e-55 AJ575101_1(AJ575101|pid:none) Wolbachia endosymbiont of Paratull... 217 9e-55 DQ256472_1(DQ256472|pid:none) Wolbachia endosymbiont of Lissorho... 217 9e-55 CP000993_287(CP000993|pid:none) Borrelia recurrentis A1, complet... 217 9e-55 CP000679_879(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 217 9e-55 AB073733_1(AB073733|pid:none) Wolbachia endosymbiont of Hishimon... 217 9e-55 AE017282_2297(AE017282|pid:none) Methylococcus capsulatus str. B... 217 9e-55 CP000048_290(CP000048|pid:none) Borrelia hermsii DAH, complete g... 216 1e-54 CP001393_732(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 216 1e-54 CP000127_2747(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 216 1e-54 CP000049_292(CP000049|pid:none) Borrelia turicatae 91E135, compl... 216 1e-54 EU684588_1(EU684588|pid:none) Brassica oleracea var. botrytis ch... 216 1e-54 CP001358_1103(CP001358|pid:none) Desulfovibrio desulfuricans sub... 216 2e-54 CP000013_297(CP000013|pid:none) Borrelia garinii PBi, complete g... 216 2e-54 DQ155389_1(DQ155389|pid:none) Uncultured Bartonella sp. cell div... 216 2e-54 CP001205_288(CP001205|pid:none) Borrelia burgdorferi ZS7, comple... 216 2e-54 L76303_2(L76303|pid:none) Borrelia burgdorferi ftsA gene, 3' end... 216 2e-54 AE000783_298(AE000783|pid:none) Borrelia burgdorferi B31, comple... 216 2e-54 AB037892_1(AB037892|pid:none) Wolbachia sp. wNaw ftsZ gene for c... 216 2e-54 AF289696_1(AF289696|pid:none) Wolbachia endosymbiont of Spalangi... 216 2e-54 AJ271750_1(AJ271750|pid:none) Nicotiana tabacum mRNA for chlorop... 216 2e-54 AJ311847_1(AJ311847|pid:none) Nicotiana tabacum chloroplast mRNA... 216 2e-54 AF289697_1(AF289697|pid:none) Wolbachia endosymbiont of Spalangi... 216 2e-54 AF289698_1(AF289698|pid:none) Wolbachia endosymbiont of Spalangi... 216 2e-54 AE010300_612(AE010300|pid:none) Leptospira interrogans serovar l... 216 2e-54 AY898806_1(AY898806|pid:none) Wolbachia endosymbiont of Aedes po... 216 2e-54 DQ093833_1(DQ093833|pid:none) Wolbachia endosymbiont of Wucherer... 215 3e-54 AY566419_1(AY566419|pid:none) Wolbachia pipientis strain wCalt2 ... 215 3e-54 CP000302_357(CP000302|pid:none) Shewanella denitrificans OS217, ... 215 3e-54 CP000821_414(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 215 3e-54 DQ093831_1(DQ093831|pid:none) Wolbachia endosymbiont of Wucherer... 215 3e-54 CP001124_493(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 215 3e-54 DQ093832_1(DQ093832|pid:none) Wolbachia endosymbiont of Wucherer... 215 3e-54 CP001472_1032(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 215 3e-54 CP000395_301(CP000395|pid:none) Borrelia afzelii PKo, complete g... 215 4e-54 CP000444_387(CP000444|pid:none) Shewanella sp. MR-7, complete ge... 214 5e-54 CP000514_2414(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 214 5e-54 CP000472_2135(CP000472|pid:none) Shewanella piezotolerans WP3, c... 214 5e-54 AJ575103_1(AJ575103|pid:none) Wolbachia endosymbiont of Mesaphor... 214 5e-54 AY956781_1(AY956781|pid:none) Pediococcus sp. Z-8 FtsZ gene, par... 214 6e-54 CP000469_3712(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 214 6e-54 AY956780_1(AY956780|pid:none) Pediococcus sp. BZ-2005 FtsZ gene,... 214 6e-54 CP000263_125(CP000263|pid:none) Buchnera aphidicola str. Cc (Cin... 214 6e-54 AY231147_1(AY231147|pid:none) Kinetoplastibacterium blastocrithi... 214 6e-54 AJ130717_1(AJ130717|pid:none) Wolbachia sp. ftsZ gene, partial. 214 8e-54 CP000094_4663(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 214 8e-54 AJ130892_1(AJ130892|pid:none) Wolbachia sp. ftsZ gene, partial. 214 8e-54 AM181176_930(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 214 8e-54 AJ005887_1(AJ005887|pid:none) Wolbachia sp. ftsZ gene, partial (... 214 8e-54 CP000768_1086(CP000768|pid:none) Campylobacter jejuni subsp. doy... 214 8e-54 AJ223243_1(AJ223243|pid:none) Wolbachia sp. (from A. vulgare) ft... 214 8e-54 U28193_1(U28193|pid:none) Wolbachia sp. group B, from specific h... 214 8e-54 CP000503_392(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 214 8e-54 CP000076_4984(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 214 8e-54 U28194_1(U28194|pid:none) Wolbachia sp. group B FtsZ (ftsZ) gene... 213 1e-53 AF289703_1(AF289703|pid:none) Wolbachia endosymbiont of Spalangi... 213 1e-53 DQ093830_1(DQ093830|pid:none) Wolbachia endosymbiont of Wucherer... 213 1e-53 AF275547_1(AF275547|pid:none) Wolbachia endosymbiont of Triboliu... 213 1e-53 AB084236_1(AB084236|pid:none) Chlamydomonas reinhardtii FtsZ mRN... 213 1e-53 AF493071_1(AF493071|pid:none) Endosymbiont of Crithidia deanei b... 213 1e-53 U28205_1(U28205|pid:none) Wolbachia sp. group B FtsZ (ftsZ) gene... 213 1e-53 CP000851_3788(CP000851|pid:none) Shewanella pealeana ATCC 700345... 213 1e-53 U28198_1(U28198|pid:none) Wolbachia sp. group B, from specific h... 213 1e-53 U28204_1(U28204|pid:none) Wolbachia sp. group B FtsZ (ftsZ) gene... 213 1e-53 CR543861_3156(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 213 1e-53 AB052554_15(AB052554|pid:none) Shewanella violacea dcw gene clus... 213 1e-53 AJ005879_1(AJ005879|pid:none) Wolbachia sp. ftsZ gene, partial (... 213 1e-53 AF011269_1(AF011269|pid:none) Wolbachia sp. cell division protei... 213 1e-53 U28202_1(U28202|pid:none) Wolbachia sp. group B, from specific h... 213 1e-53 CP000961_4478(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 213 1e-53 U83105_1(U83105|pid:none) Wolbachia sp. cell division protein Ft... 213 1e-53 AJ005885_1(AJ005885|pid:none) Wolbachia sp. ftsZ gene, partial (... 213 1e-53 AM180252_1108(AM180252|pid:none) Lawsonia intracellularis PHE/MN... 213 1e-53 U28199_1(U28199|pid:none) Wolbachia sp. group B, from specific h... 213 1e-53 AJ318488_1(AJ318488|pid:none) Wolbachia sp. partial ftsZ homolog... 213 1e-53 CP000027_623(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 213 1e-53 CP000588_209(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 213 1e-53 AJ010266_1(AJ010266|pid:none) Wolbachia endosymbiont of Onchocer... 213 1e-53 (P57308) RecName: Full=Cell division protein ftsZ; &A84955(A849... 213 1e-53 AJ010272_1(AJ010272|pid:none) Wolbachia endosymbiont of Dirofila... 213 1e-53 AE016828_128(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 213 1e-53 AE016853_4299(AE016853|pid:none) Pseudomonas syringae pv. tomato... 213 2e-53 AJ005881_1(AJ005881|pid:none) Wolbachia sp. ftsZ gene, partial (... 213 2e-53 CP000238_468(CP000238|pid:none) Baumannia cicadellinicola str. H... 213 2e-53 AJ010269_1(AJ010269|pid:none) Wolbachia endosymbiont of Brugia m... 213 2e-53 AJ509027_1(AJ509027|pid:none) Wolbachia endosymbiont of Folsomia... 213 2e-53 AY956787_1(AY956787|pid:none) Pediococcus sp. J-11 FtsZ gene, pa... 213 2e-53 EU499321_1(EU499321|pid:none) Wolbachia endosymbiont of Bryobia ... 213 2e-53 CP000058_3913(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 213 2e-53 Y13666_1(Y13666|pid:none) Wolbachia sp. ftsZ gene, partial (spec... 212 2e-53 AY567689_1(AY567689|pid:none) Wolbachia endosymbiont of Asobara ... 212 2e-53 AB003132_3(AB003132|pid:none) Corynebacterium glutamicum gene fo... 212 2e-53 CP001277_1594(CP001277|pid:none) Candidatus Hamiltonella defensa... 212 2e-53 AY567699_1(AY567699|pid:none) Wolbachia endosymbiont of Asobara ... 212 2e-53 U28182_1(U28182|pid:none) Wolbachia sp. group A FtsZ (ftsZ) gene... 212 2e-53 AF011270_1(AF011270|pid:none) Wolbachia sp. cell division protei... 212 2e-53 AF062593_1(AF062593|pid:none) Wolbachia sp. 'Trichogramma bourar... 212 2e-53 U39877_1(U39877|pid:none) Arabidopsis thaliana cpFtsZ (cpFtsZ) m... 212 2e-53 Y13281_1(Y13281|pid:none) Wolbachia sp. ftsZ gene, partial (spec... 212 2e-53 AY567692_1(AY567692|pid:none) Wolbachia endosymbiont of Asobara ... 212 2e-53 CR628337_2542(CR628337|pid:none) Legionella pneumophila str. Len... 212 2e-53 U28179_1(U28179|pid:none) Wolbachia sp. group A, from specific h... 212 2e-53 U28186_1(U28186|pid:none) Wolbachia sp. group A, from specific h... 212 2e-53 CP000934_2857(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 212 2e-53 CP001158_197(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 212 2e-53 AJ010267_1(AJ010267|pid:none) Wolbachia endosymbiont of Onchocer... 212 3e-53 U74479_1(U74479|pid:none) Wolbachia pipientis specific-host Tric... 212 3e-53 AE017340_440(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 212 3e-53 CP001323_494(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 212 3e-53 U74485_1(U74485|pid:none) Wolbachia pipientis specific-host Tric... 212 3e-53 CP001600_700(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 212 3e-53 CP000423_1192(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 211 4e-53 AY774132_1(AY774132|pid:none) Synthetic construct Francisella tu... 211 4e-53 AJ005888_1(AJ005888|pid:none) Wolbachia sp. ftsZ gene, partial (... 211 4e-53 U74484_1(U74484|pid:none) Wolbachia pipientis specific-host Tric... 211 4e-53 U83099_1(U83099|pid:none) Wolbachia sp. cell division protein Ft... 211 4e-53 U28200_1(U28200|pid:none) Wolbachia sp. group B, from specific h... 211 4e-53 AJ965256_517(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 211 4e-53 CT573326_4165(CT573326|pid:none) Pseudomonas entomophila str. L4... 211 4e-53 AJ010268_1(AJ010268|pid:none) Wolbachia endosymbiont of Onchocer... 211 4e-53 (Q59692) RecName: Full=Cell division protein ftsZ; &AE015451_13... 211 4e-53 CP000142_2346(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 211 4e-53 CP000653_638(CP000653|pid:none) Enterobacter sp. 638, complete g... 211 4e-53 CP000439_163(CP000439|pid:none) Francisella tularensis subsp. no... 211 4e-53 CP000883_127(CP000883|pid:none) Hemiselmis andersenii chromosome... 211 4e-53 U28183_1(U28183|pid:none) Wolbachia sp. group A, from specific h... 211 5e-53 AJ250967_1(AJ250967|pid:none) Wolbachia sp. partial ftsZ gene, s... 211 5e-53 AJ010271_1(AJ010271|pid:none) Wolbachia endosymbiont of Litomoso... 211 5e-53 AE016825_4338(AE016825|pid:none) Chromobacterium violaceum ATCC ... 211 5e-53 CP000932_1133(CP000932|pid:none) Campylobacter lari RM2100, comp... 211 5e-53 CP001089_651(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 211 5e-53 U28177_1(U28177|pid:none) Wolbachia sp. group A, from specific h... 211 5e-53 AY567698_1(AY567698|pid:none) Wolbachia endosymbiont of Asobara ... 211 5e-53 CP001616_528(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 211 5e-53 AJ250964_1(AJ250964|pid:none) Wolbachia sp. partial ftsZ gene, s... 211 5e-53 AY567687_1(AY567687|pid:none) Wolbachia endosymbiont of Asobara ... 211 7e-53 AP008981_905(AP008981|pid:none) Orientia tsutsugamushi str. Iked... 211 7e-53 FJ456917_1(FJ456917|pid:none) Paulinella chromatophora strain FK... 211 7e-53 AF289704_1(AF289704|pid:none) Wolbachia endosymbiont of Spalangi... 211 7e-53 (P0A029) RecName: Full=Cell division protein ftsZ; &(P0A030) Re... 211 7e-53 EU914260_1(EU914260|pid:none) Staphylococcus aureus strain NS/19... 211 7e-53 BX950851_3785(BX950851|pid:none) Erwinia carotovora subsp. atros... 211 7e-53 AP006725_819(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 210 9e-53 CR954208_217(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 210 9e-53 EU914259_1(EU914259|pid:none) Staphylococcus aureus strain NS/19... 210 9e-53 CP000783_3156(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 210 9e-53 DQ489736_532(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 210 1e-52 EU914264_1(EU914264|pid:none) Staphylococcus aureus strain GG/19... 210 1e-52 AE006468_133(AE006468|pid:none) Salmonella enterica subsp. enter... 210 1e-52 CU468135_760(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 210 1e-52 AJ010270_1(AJ010270|pid:none) Wolbachia endosymbiont of Brugia p... 210 1e-52 FP236842_748(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 210 1e-52 BX571871_111(BX571871|pid:none) Photorhabdus luminescens subsp. ... 210 1e-52 AJ131709_1(AJ131709|pid:none) Wolbachia endosymbiont of Dirofila... 209 1e-52 AY567690_1(AY567690|pid:none) Wolbachia endosymbiont of Asobara ... 209 1e-52 AY227738_1(AY227738|pid:none) Wolbachia sp. wCer2 FtsZ (ftsZ) ge... 209 1e-52 AJ010592_10(AJ010592|pid:none) Guillardia theta DNA for complete... 209 1e-52 CP000606_3442(CP000606|pid:none) Shewanella loihica PV-4, comple... 209 1e-52 AP008232_453(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 209 1e-52 AY227737_1(AY227737|pid:none) Wolbachia sp. wCer1 FtsZ (ftsZ) ge... 209 1e-52 DQ093828_1(DQ093828|pid:none) Wolbachia endosymbiont of Aedes po... 209 1e-52 AJ007748_1(AJ007748|pid:none) Guillardia theta ftsZ gene. 209 1e-52 CP000826_762(CP000826|pid:none) Serratia proteamaculans 568, com... 209 1e-52 AM286415_641(AM286415|pid:none) Yersinia enterocolitica subsp. e... 209 2e-52 DQ520267_1(DQ520267|pid:none) Vibrio parahaemolyticus strain ATC... 209 2e-52 AY567705_1(AY567705|pid:none) Wolbachia endosymbiont of Asobara ... 209 2e-52 Y14954_1(Y14954|pid:none) Wolbachia sp. ftsZ gene, partial (spec... 209 2e-52 DQ520266_1(DQ520266|pid:none) Vibrio parahaemolyticus strain 04-... 209 2e-52 (Q5HQ06) RecName: Full=Cell division protein ftsZ; &CP000029_73... 209 2e-52 AF012886_4(AF012886|pid:none) Buchnera aphidicola truncated UDP-... 209 2e-52 BA000037_618(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 209 3e-52 AM295250_794(AM295250|pid:none) Staphylococcus carnosus subsp. c... 209 3e-52 DQ520276_1(DQ520276|pid:none) Vibrio vulnificus strain 90-298 Ft... 209 3e-52 AB119059_1(AB119059|pid:none) Nannochloris bacillaris NbftsZ2 ge... 209 3e-52 FM954972_404(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 209 3e-52 CP000880_2761(CP000880|pid:none) Salmonella enterica subsp. ariz... 209 3e-52 CP000038_100(CP000038|pid:none) Shigella sonnei Ss046, complete ... 209 3e-52 AM286690_603(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 209 3e-52 CP000941_1855(CP000941|pid:none) Xylella fastidiosa M12, complet... 208 3e-52 CP001104_695(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 208 3e-52 AJ239100_1(AJ239100|pid:none) Acholeplasma laidlawii ftsZ gene. ... 208 3e-52 EU914261_1(EU914261|pid:none) Staphylococcus aureus strain GG/19... 208 3e-52 (Q83MF6) RecName: Full=Cell division protein ftsZ; &AE005674_92... 208 3e-52 AE003849_799(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 208 3e-52 T10476(T10476) cell division protein ftsZ - Pseudomonas putida ... 208 3e-52 AP009484_760(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 208 3e-52 AF289699_1(AF289699|pid:none) Wolbachia endosymbiont of Spalangi... 208 3e-52 EU914263_1(EU914263|pid:none) Staphylococcus aureus strain GG/19... 208 3e-52 U74476_1(U74476|pid:none) Wolbachia pipientis specific-host Tric... 208 3e-52 CP000414_1412(CP000414|pid:none) Leuconostoc mesenteroides subsp... 208 3e-52 BX248583_139(BX248583|pid:none) Blochmannia floridanus complete ... 208 3e-52 AY956782_1(AY956782|pid:none) Pediococcus sp. Z-9 FtsZ gene, par... 208 3e-52 CP001139_2221(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 208 4e-52 AE017226_1194(AE017226|pid:none) Treponema denticola ATCC 35405,... 208 4e-52 AP008934_1585(AP008934|pid:none) Staphylococcus saprophyticus su... 208 4e-52 DQ520275_1(DQ520275|pid:none) Vibrio vulnificus strain 92-1751 F... 207 6e-52 (P0A0S5) RecName: Full=Cell division protein ftsZ; &(P0A0S6) Re... 207 6e-52 CP001087_1265(CP001087|pid:none) Desulfobacterium autotrophicum ... 207 6e-52 AE013598_3738(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 207 7e-52 AE008923_780(AE008923|pid:none) Xanthomonas axonopodis pv. citri... 207 7e-52 AE005672_1574(AE005672|pid:none) Streptococcus pneumoniae TIGR4,... 207 7e-52 AF068901_8(AF068901|pid:none) Streptococcus pneumoniae penicilli... 207 7e-52 AM039952_835(AM039952|pid:none) Xanthomonas campestris pv. vesic... 207 7e-52 AM933172_133(AM933172|pid:none) Salmonella enterica subsp. enter... 207 7e-52 X55034_22(X55034|pid:none) E. coli 2 minute region. 207 7e-52 CP000462_3737(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 207 7e-52 CP000919_1485(CP000919|pid:none) Streptococcus pneumoniae JJA, c... 207 7e-52 CP000159_549(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 207 7e-52 AP008229_3599(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 207 7e-52 AM743169_719(AM743169|pid:none) Stenotrophomonas maltophilia K27... 207 1e-51 CP000023_698(CP000023|pid:none) Streptococcus thermophilus LMG 1... 207 1e-51 AY198132_5(AY198132|pid:none) Spiroplasma kunkelii YlbN, hypothe... 207 1e-51 AP007281_574(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 207 1e-51 CP000896_678(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 207 1e-51 CP000680_920(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 207 1e-51 EF658738_1(EF658738|pid:none) Wolbachia endosymbiont of Pristoph... 207 1e-51 AM114193_22(AM114193|pid:none) Uncultured methanogenic archaeon ... 207 1e-51 CP001111_607(CP001111|pid:none) Stenotrophomonas maltophilia R55... 207 1e-51 CP000285_2171(CP000285|pid:none) Chromohalobacter salexigens DSM... 206 1e-51 CP000744_4919(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 206 2e-51 FM209186_4786(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 206 2e-51 CP000083_4325(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 206 2e-51 DQ520262_1(DQ520262|pid:none) Vibrio alginolyticus strain 86-148... 206 2e-51
>(Q54Z54) RecName: Full=Mitochondrial division protein fszA; Length = 517
Score = 588 bits (1516), Expect = e-166 Identities = 315/387 (81%), Positives = 315/387 (81%) Frame = +1
Query: 10 MSQFMIRYQIINLSKVFNSPKSLNFIKRYXXXXXXXXXXXXNDDSNWISTPNITVCGIGG 189 MSQFMIRYQIINLSKVFNSPKSLNFIKRY NDDSNWISTPNITVCGIGG Sbjct: 1 MSQFMIRYQIINLSKVFNSPKSLNFIKRYTTSTASTTTTTTNDDSNWISTPNITVCGIGG 60
Query: 190 GGCNSVNNMINKELYGIDFVVANTDAQALAISCSRKMVQLGKTLTRGLGAGAVPEVGKKA 369 GGCNSVNNMINKELYGIDFVVANTDAQALAISCSRKMVQLGKTLTRGLGAGAVPEVGKKA Sbjct: 61 GGCNSVNNMINKELYGIDFVVANTDAQALAISCSRKMVQLGKTLTRGLGAGAVPEVGKKA 120
Query: 370 TEESIEELMNQIGDTQMLFXXXXXXXXXXXXXXXXXXXXXXXXXXLTVGIVTKPFHFEGK 549 TEESIEELMNQIGDTQMLF LTVGIVTKPFHFEGK Sbjct: 121 TEESIEELMNQIGDTQMLFVTAGMGGGTGTGGAAVIASAAKAKGILTVGIVTKPFHFEGK 180
Query: 550 HRMKLAEQGLIELEKSVDSLIVIPNEKLMEQSQELYIGNAFQMVDDVLYNSIRGISDILV 729 HRMKLAEQGLIELEKSVDSLIVIPNEKLMEQSQELYIGNAFQMVDDVLYNSIRGISDILV Sbjct: 181 HRMKLAEQGLIELEKSVDSLIVIPNEKLMEQSQELYIGNAFQMVDDVLYNSIRGISDILV 240
Query: 730 KPGLINLDFADVRSIMCNSGKALMGVGEGEGKGRDXXXXXXXXXXXXXXXXXXXGAKGVL 909 KPGLINLDFADVRSIMCNSGKALMGVGEGEGKGRD GAKGVL Sbjct: 241 KPGLINLDFADVRSIMCNSGKALMGVGEGEGKGRDAIAANIALNNPLLENINISGAKGVL 300
Query: 910 LNIXGSDLKLQEVDHIVSLVSSKVDPSXNIIFGSTFDQQLEGXIRVTLIVTGMDXXXXXX 1089 LNI GSDLKLQEVDHIVSLVSSKVDPS NIIFGSTFDQQLEG IRVTLIVTGMD Sbjct: 301 LNIAGSDLKLQEVDHIVSLVSSKVDPSANIIFGSTFDQQLEGKIRVTLIVTGMDQLIQQQ 360
Query: 1090 XXXXXXTKIESQVEQKLHSTTIVDQEL 1170 TKIESQVEQKLHSTTIVDQEL Sbjct: 361 QQQQKQTKIESQVEQKLHSTTIVDQEL 387
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,432,669,438 Number of extensions: 21854700 Number of successful extensions: 79345 Number of sequences better than 10.0: 929 Number of HSP's gapped: 76224 Number of HSP's successfully gapped: 1056 Length of query: 467 Length of database: 1,051,180,864 Length adjustment: 132 Effective length of query: 335 Effective length of database: 623,955,076 Effective search space: 209024950460 Effective search space used: 209024950460 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|