Contig-U15509-1 |
Contig ID |
Contig-U15509-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1365 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
204341 |
End point |
202976 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
8 |
Number of EST |
13 |
Link to clone list |
U15509 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 1.30 |
Homology vs DNA |
Query= Contig-U15509-1 (Contig-U15509-1Q) /CSM_Contig/Contig-U15509-1Q.Seq.d (1375 letters)
Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AF073837) Dictyostelium discoideum calnexin precursor, gene... 1033 0.0 2 (BJ435261) Dictyostelium discoideum cDNA clone:ddv26h13, 3' ... 1025 0.0 2 (BJ342789) Dictyostelium discoideum cDNA clone:dda1i14, 3' e... 971 0.0 3 (BJ401820) Dictyostelium discoideum cDNA clone:dds19b16, 3' ... 969 0.0 2 (BJ339879) Dictyostelium discoideum cDNA clone:dda10c21, 3' ... 967 0.0 2 (AU284815) Dictyostelium discoideum gamete cDNA clone:FC-BL2... 817 0.0 2 (BJ389634) Dictyostelium discoideum cDNA clone:dds19b16, 5' ... 1041 0.0 1 (BJ323478) Dictyostelium discoideum cDNA clone:dda10c21, 5' ... 1041 0.0 1 (BJ325605) Dictyostelium discoideum cDNA clone:dda1i14, 5' e... 1015 0.0 1 (AU284814) Dictyostelium discoideum gamete cDNA clone:FC-BL2... 1007 0.0 1 (BJ381304) Dictyostelium discoideum cDNA clone:ddc41h05, 3' ... 769 0.0 2 (AU053496) Dictyostelium discoideum slug cDNA, clone SLI776. 680 0.0 2 (BJ367031) Dictyostelium discoideum cDNA clone:ddc41h05, 5' ... 846 0.0 1 (AU053518) Dictyostelium discoideum slug cDNA, clone SLI827. 285 e-145 2 (AU062266) Dictyostelium discoideum slug cDNA, clone SLI827. 482 e-131 1 (BJ416487) Dictyostelium discoideum cDNA clone:ddv26h13, 5' ... 432 e-120 2 (BJ404837) Dictyostelium discoideum cDNA clone:dds29d23, 3' ... 192 2e-44 1 (AY392161) Scyliorhinus canicula calreticulin mRNA, partial ... 56 1e-04 2 (DV439508) davisf0008I12 Fragaria vesca 'Yellow Wonder' flow... 46 0.002 2 (DV440505) davisf2008B07 Fragaria vesca 'Yellow Wonder' flow... 46 0.002 2 (AF019376) Brassica napus calreticulin mRNA, complete cds. 50 0.004 3 (CU355570) Aphanomyces euteiches cDNA. 42 0.005 2 (CU365405) Aphanomyces euteiches cDNA. 42 0.005 2 (CU348886) Aphanomyces euteiches cDNA. 42 0.005 2 (CU359380) Aphanomyces euteiches cDNA. 42 0.005 2 (CU356560) Aphanomyces euteiches cDNA. 42 0.005 2 (CU355690) Aphanomyces euteiches cDNA. 42 0.005 2 (CU357408) Aphanomyces euteiches cDNA. 42 0.005 2 (CU363855) Aphanomyces euteiches cDNA. 42 0.005 2 (CU364983) Aphanomyces euteiches cDNA. 42 0.005 2 (CU348797) Aphanomyces euteiches cDNA. 42 0.005 2 (CU353808) Aphanomyces euteiches cDNA. 42 0.005 2 (CU353753) Aphanomyces euteiches cDNA. 42 0.006 2 (CU348819) Aphanomyces euteiches cDNA. 42 0.006 2 (CU349449) Aphanomyces euteiches cDNA. 42 0.006 2 (CU354697) Aphanomyces euteiches cDNA. 42 0.006 2 (CU364276) Aphanomyces euteiches cDNA. 42 0.006 2 (CU351356) Aphanomyces euteiches cDNA. 42 0.006 2 (CU357053) Aphanomyces euteiches cDNA. 42 0.006 2 (CU354867) Aphanomyces euteiches cDNA. 42 0.006 2 (CU354727) Aphanomyces euteiches cDNA. 42 0.006 2 (CU367012) Aphanomyces euteiches cDNA. 42 0.006 2 (CU356518) Aphanomyces euteiches cDNA. 42 0.006 2 (CU359831) Aphanomyces euteiches cDNA. 42 0.006 2 (CU350390) Aphanomyces euteiches cDNA. 42 0.006 2 (CU353232) Aphanomyces euteiches cDNA. 42 0.006 2 (CU352582) Aphanomyces euteiches cDNA. 42 0.006 2 (CU350990) Aphanomyces euteiches cDNA. 42 0.006 2 (CU357695) Aphanomyces euteiches cDNA. 42 0.006 2 (EE121687) G710P5406RG3.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (EE121164) G710P5365RG9.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (EE118346) G709P53RE2.T0 Acorn worm normalized neurula pExpr... 54 0.014 1 (EE116248) G708P51RF5.T0 Acorn worm normalized gastrula pExp... 54 0.014 1 (EE115210) G613P6335RH10.T0 Acorn worm blastula/gastrula pCM... 54 0.014 1 (EE113579) G50P6272RH2.T0 Acorn worm gastrula/neurula pCMVSp... 54 0.014 1 (BB977417) Plasmodium berghei str. ANKA cDNA clone: OK007388... 54 0.014 1 (BB976945) Plasmodium berghei str. ANKA cDNA clone: OK006887... 54 0.014 1 (BB976239) Plasmodium berghei str. ANKA cDNA clone: OK006104... 54 0.014 1 (BB972017) Plasmodium berghei str. ANKA cDNA clone: OK001711... 54 0.014 1 (BB971628) Plasmodium berghei str. ANKA cDNA clone: OK001305... 54 0.014 1 (BB970910) Plasmodium berghei str. ANKA cDNA clone: OK000561... 54 0.014 1 (FF672551) G826P5398RF1.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF668624) G826P5370RE2.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF649844) G826P5232RA7.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF649775) G826P5231FE6.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF648224) G826P5221RD7.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF610336) G825P5152FC1.T0 Acorn worm normalized gastrula pE... 54 0.014 1 (FF518598) G710P5214FE7.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF517895) G710P5209FB4.T0 Acorn worm normalized juvenile pE... 54 0.014 1 (FF509677) G709P5234RF5.T0 Acorn worm normalized neurula pEx... 54 0.014 1 (FF507276) G709P5216RA4.T0 Acorn worm normalized neurula pEx... 54 0.014 1 (FF500273) G709P5106RF4.T0 Acorn worm normalized neurula pEx... 54 0.014 1 (FF495870) G708P536FC9.T0 Acorn worm normalized gastrula pEx... 54 0.014 1 (FF488502) G708P5154RE6.T0 Acorn worm normalized gastrula pE... 54 0.014 1 (FF487555) G708P5142RH7.T0 Acorn worm normalized gastrula pE... 54 0.014 1 (FF458757) G50P6044RB3.T0 Acorn worm gastrula/neurula pCMVSp... 54 0.014 1 (EX749794) RR1CR13TF RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.016 2 (EX089162) BR075452 flower cDNA library KFFB Brassica rapa s... 50 0.020 2 (AT002058) Brassica rapa subsp. pekinensis flower bud partia... 50 0.037 2 (DY641848) PU3_plate9_N18 PU3 Prunus persica cDNA similar to... 38 0.054 2 (DC224901) Plasmodium berghei strain ANKA cDNA clone:SG00119... 52 0.056 1 (EX904293) RS3C676TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 42 0.057 2 (AF134733) Prunus armeniaca calcium-binding protein calretic... 38 0.14 2 (L22736) Dictyostelium discoideum heat shock protein (hspB) ... 42 0.18 2 (X75263) D.discoideum (AX3) mRNA for heat shock cognate prot... 42 0.18 2 (AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 34 0.19 11 (CN925470) 000512AENA001343HT (AENA) Northern Spy expanding ... 38 0.19 2 (ES596809) 000001604452_D07.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES594078) 000001602852_I19.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES592390) 000001602252_M18.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES590519) 000001601552_O22.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES589472) 000001480352_I21.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES589471) 000001480352_I20.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES588591) 000001480052_K20.ab1 Eucalyptus globulus under lo... 50 0.22 1 (ES268206) 69JKME5D_T3_025_C12_30MAR2005_092 69JKME5D Brassi... 50 0.22 1 (EG379477) BG01015B2E05.f1 BG01 - normalized library Leymus ... 50 0.22 1 (EE529559) 39RDBRT_UP_062_B02_30NOV2005_014 Brassica rapa 39... 50 0.22 1 (EE525659) 37RDBRH_UP_044_G08_09JUL2004_052 Brassica rapa 37... 50 0.22 1 (EE521144) 36RDBRG_UP_061_F05_29NOV2005_037 Brassica rapa 36... 50 0.22 1 (EE520861) 36RDBRG_UP_057_E08_22NOV2005_056 Brassica rapa 36... 50 0.22 1 (EE520608) 36RDBRG_UP_053_H07_22NOV2005_049 Brassica rapa 36... 50 0.22 1 (EE519440) 36RDBRG_UP_039_H06_24JUN2004_034 Brassica rapa 36... 50 0.22 1 (EE519083) 36RDBRG_UP_035_H07_23JUN2004_049 Brassica rapa 36... 50 0.22 1 (EE517241) 36RDBRG_UP_013_H06_11JUN2004_034 Brassica rapa 36... 50 0.22 1 (EE483668) DHBN6DCT_UP_006_C02_16FEB2005_012 BRASSICA NAPUS ... 50 0.22 1 (EE482870) BNYS8DCT_UP_031_G01_21APR2005_003 Brassica napus ... 50 0.22 1 (EE463753) BNSCS2CT_UP_015_D09_06JAN2005_073 Brassica napus ... 50 0.22 1 (EE462306) BNDH5DCT_UP_024_G10_27JAN2004_068 Brassica napus ... 50 0.22 1 (EE456674) BNBS6DCT_UP_011_A04_12APR2005_032 Brassica napus ... 50 0.22 1 (EE452071) BNBS2DCT_UP_014_H05_11MAR2005_033 Brassica napus ... 50 0.22 1 (EE446405) 73ETGS36_UP_020_G04_25MAY2005_020 73ETGS36 Brassi... 50 0.22 1 (EE433025) 35ETGS60_UP_022_H08_12FEB2005_050 Brassica napus ... 50 0.22 1 (EE427958) 33ETGS36_UP_006_B08_15MAR2004_062 Brassica napus ... 50 0.22 1 (EE402885) 16ACDHDS_UP_016_B04_15OCT2004_030 Brassica napus ... 50 0.22 1 (DY018799) 48RDOAM_UP_034_H12_14SEP2004_082 O. Alba 48RDOAM ... 50 0.22 1 (DY015968) 40JKME7D_UP_015_E02_21MAY2004_008 40JKME7D Brassi... 50 0.22 1 (DY015619) 48RDOAM_UP_027_A03_13AUG2004_031 O. Alba 48RDOAM ... 50 0.22 1 (DY014662) 48RDOAM_UP_014_F10_14AUG2004_070 O. Alba 48RDOAM ... 50 0.22 1 (DY013581) 8RDBRH_UP_025_G06_17SEP2003_036 Brassica rapa - 8... 50 0.22 1 (DY005916) BNDH4DCT_UP_012_F07_16DEC2004_053 Brassica napus ... 50 0.22 1 (CX271563) 39RDBRT_UP_028_E05_20JUL2004_039 Brassica rapa 39... 50 0.22 1 (CX271139) 39RDBRT_UP_019_B06_05APR2004_046 Brassica rapa 39... 50 0.22 1 (CF577421) MCSA222G03 Maturing Sugarcane Stem Lambda ZIPLOX ... 50 0.22 1 (CF489022) POL1_53_G06.g1_A002 Pollen Sorghum bicolor cDNA c... 50 0.22 1 (CD837819) BN45.053K17F020107 BN45 Brassica napus cDNA clone... 50 0.22 1 (CD836033) BN45.047H13F020102 BN45 Brassica napus cDNA clone... 50 0.22 1 (CD825882) BN25.062B18F011130 BN25 Brassica napus cDNA clone... 50 0.22 1 (CD813739) BN15.020N09F020211 BN15 Brassica napus cDNA clone... 50 0.22 1 (CD470851) LeukoS5_2_C12.g1_A027 Stimulated peripheral blood... 50 0.22 1 (CD428924) ETH1_1_F06.g1_A002 Ethylene-treated seedlings Sor... 50 0.22 1 (CD231647) SS1_22_E10.g1_A012 Salt-stressed seedlings Sorghu... 50 0.22 1 (CD210742) HS1_49_D06.g1_A012 Heat-shocked seedlings Sorghum... 50 0.22 1 (CA266497) SCAGLB2048H09.g LB2 Saccharum officinarum cDNA cl... 50 0.22 1 (CA195995) SCSBAD1083D12.g AD1 Saccharum officinarum cDNA cl... 50 0.22 1 (CA172768) SCUTSB1030A02.g SB1 Saccharum officinarum cDNA cl... 50 0.22 1 (CA166660) SCVPRZ3028C12.g RZ3 Saccharum officinarum cDNA cl... 50 0.22 1 (CA138836) SCEQRT2090E04.g RT2 Saccharum officinarum cDNA cl... 50 0.22 1 (CA103851) SCEZHR1087D02.g HR1 Saccharum officinarum cDNA cl... 50 0.22 1 (CA071672) SCBGAM1089D02.g AM1 Saccharum officinarum cDNA cl... 50 0.22 1 (CA069035) SCSBAD1051E04.g AD1 Saccharum officinarum cDNA cl... 50 0.22 1 (FG570436) BN18DYSC_UP_204_H04_7APR2008_018 BN18DYSC Brassic... 50 0.22 1 (FG564638) BN18DYSC_UP_138_G04_3APR2008_020 BN18DYSC Brassic... 50 0.22 1 (FG556820) BN18DYSC_UP_045_C08_20FEB2008_060 BN18DYSC Brassi... 50 0.22 1 (FD551218) RR3FH91TF RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.22 1 (EX746236) RR1BM31TF RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.22 1 (EX036039) BR020683 floral bud cDNA library KBFL Brassica ra... 50 0.22 1 (EV526040) RR1AI67TF RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.22 1 (EV215743) 0188854 Brassica napus Leaf - drought Brassica na... 50 0.22 1 (EV211384) 0182574 Brassica napus Leaf - drought Brassica na... 50 0.22 1 (EV192791) 0090273 Brassica napus Cold acclimation - dark Br... 50 0.22 1 (EV154826) 0078687 Brassica napus Bud library Brassica napus... 50 0.22 1 (EV154745) 0078606 Brassica napus Bud library Brassica napus... 50 0.22 1 (EV153502) 0077362 Brassica napus Bud library Brassica napus... 50 0.22 1 (EV151510) 0141432 Brassica napus Early anther Brassica napu... 50 0.22 1 (EV120056) 0125368 Brassica napus Root library Brassica napu... 50 0.22 1 (EV119357) 0124669 Brassica napus Root library Brassica napu... 50 0.22 1 (EV118976) 0124288 Brassica napus Root library Brassica napu... 50 0.22 1 (EV090542) BNSCS5CT_UP_175_E03_01JUN2007_023 Brassica napus ... 50 0.22 1 (EV059156) BNSCS3CT_UP_281_A05_30MAY2007_047 Brassica napus ... 50 0.22 1 (EV051914) BNSCS3CT_UP_190_G09_13MAY2007_067 Brassica napus ... 50 0.22 1 (EV047864) BNSCS3CT_UP_141_C11_10MAY2007_091 Brassica napus ... 50 0.22 1 (EV034916) BNSCS2CT_UP_263_D07_03MAY2007_057 Brassica napus ... 50 0.22 1 (EV033921) BNSCS2CT_UP_249_H04_03MAY2007_018 Brassica napus ... 50 0.22 1 (EV033854) BNSCS2CT_UP_248_H04_03MAY2007_018 Brassica napus ... 50 0.22 1 (ES991210) BNAEN1GH_UP_064_C11_22JUL2006_091 Brassica napus ... 50 0.22 1 (ES945053) 48RDOAM_UP_076_E09_04FEB2006_071 Brassica olerace... 50 0.22 1 (ES943490) 48RDOAM_UP_057_B04_03FEB2006_030 Brassica olerace... 50 0.22 1 (ES941887) 47RDOAH_UP_074_A02_31JAN2006_016 Brassica olerace... 50 0.22 1 (ES937012) 39RDBRT_UP_090_F02_25JAN2006_006 Brassica rapa 39... 50 0.22 1 (ES931992) 37RDBRH_UP_079_E07_23JAN2006_055 Brassica rapa 37... 50 0.22 1 (ES931608) 36RDBRG_UP_105_F09_20JAN2006_069 Brassica rapa 36... 50 0.22 1 (ES929119) 36RDBRG_UP_076_B07_19JAN2006_061 Brassica rapa 36... 50 0.22 1 (ES927986) 26RDBNT_UP_098_C01_10MAR2006_011 Brassica napus 2... 50 0.22 1 (ES900551) BNARO1GH_T3_011_H10_22NOV2006_066 Brassica napus ... 50 0.22 1 (CF133448) WHE4358_B03_D06ZT Wheat meiotic floret cDNA libra... 46 0.25 2 (CU350051) Aphanomyces euteiches cDNA. 42 0.30 2 (AY484461) Dictyostelium discoideum kinesin family member 6 ... 34 0.58 2 (FD072440) CBFH14488.g1 CBFH: Normalized blue catfish cDNA l... 42 0.69 2 (EG968893) TH48-588 Tamarix hispida roots Tamarix hispida cD... 42 0.83 2 (AY389898) Protopterus dolloi calreticulin mRNA, partial cds. 48 0.88 1 (CU468430) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.88 1 (EK415934) 1095515463794 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.88 1 (DY978060) CLSS11818.b1_D04.ab1 CLS(LMS) lettuce sativa Lact... 48 0.88 1 (CO793726) NT018C_E05 St18-22 Neural tube (NT) Ambystoma mex... 48 0.88 1 (CO793080) NT016D_C11 St18-22 Neural tube (NT) Ambystoma mex... 48 0.88 1 (CO788882) NT005B_G06 St18-22 Neural tube (NT) Ambystoma mex... 48 0.88 1 (CO787478) NT001C_C09 St18-22 Neural tube (NT) Ambystoma mex... 48 0.88 1 (CO783806) BL279A_A04 6-Day Axolotl Tail Blastema (6DAxBL) A... 48 0.88 1 (CN064076) Ag2_p46_EO_I17_M13R AG Ambystoma tigrinum tigrinu... 48 0.88 1 (CN060975) A21_Ag2_p10_A16_M13R AG Ambystoma tigrinum tigrin... 48 0.88 1 (CN058273) Salamander_2_M06.ab1 AG Ambystoma tigrinum tigrin... 48 0.88 1 (CN056162) Salamander_22_O04.ab1 AG Ambystoma tigrinum tigri... 48 0.88 1 (FD161453) CBZC5071.g1 CBZC: Normalized blue catfish cDNA li... 42 0.91 2 (FD230997) CBZF22244.g1 CBZF: Normalized blue catfish cDNA l... 42 0.96 2 (CU350039) Aphanomyces euteiches cDNA. 42 1.1 2 (EK039371) 1092959502187 Global-Ocean-Sampling_GS-31-01-01-1... 44 1.1 2 (AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 42 1.9 7 (CK405519) AUF_IfSpn_233_h09 Ictalurus furcatus spleen cDNA ... 36 2.1 2 (BJ032721) Xenopus laevis cDNA clone:XL017i16, 5' end, singl... 38 2.6 2 (AW198923) da08f12.x1 Xenopus laevis oocyte Xenopus laevis c... 38 3.0 2 (BJ074687) Xenopus laevis cDNA clone:XL071c01, 5' end, singl... 38 3.1 2 (BJ097234) Xenopus laevis cDNA clone:XL173n06, 5' end, singl... 38 3.1 2 (DC113566) Xenopus laevis NBRP cDNA clone:xl266a15, 5' end. 38 3.2 2 (BJ624832) Xenopus laevis cDNA clone:XL209l12, 5' end. 38 3.3 2 (BJ080544) Xenopus laevis cDNA clone:XL068d03, 3' end, singl... 38 3.4 2 (AW635725) bl37d06.w1 Blackshear/Soares normalized Xenopus e... 38 3.5 2 (EF058599) Synthetic construct Saccharomyces cerevisiae clon... 46 3.5 1 (AC114617) Mus musculus chromosome 5, clone RP24-84E3, compl... 46 3.5 1 (AC113303) Mus musculus chromosome 5, clone RP23-431E5, comp... 46 3.5 1 (X82578) P.argentatum mRNA for calreticulin. 46 3.5 1 (X59720) S.cerevisiae chromosome III complete DNA sequence. 46 3.5 1 (AB026655) Arabidopsis thaliana genomic DNA, chromosome 3, P... 46 3.5 1 (DL099469) Diagnosis of existing illnesses or that praedispo... 46 3.5 1 (DL099468) Diagnosis of existing illnesses or that praedispo... 46 3.5 1 (DL022834) Diagnosis of existing illnesses or that praedispo... 46 3.5 1 (DL022833) Diagnosis of existing illnesses or that praedispo... 46 3.5 1 (DJ205082) Method for identification of useful proteins deri... 46 3.5 1 (DJ025871) Genome-wide DNA marker of Saccharomyces cerevisiae. 46 3.5 1 (CQ893718) Sequence 6 from Patent WO2004087903. 46 3.5 1 (AX509823) Sequence 4518 from Patent WO0216655. 46 3.5 1 (AC024809) Caenorhabditis elegans cosmid Y53G8AR, complete s... 46 3.5 1 (AC201082) Strongylocentrotus purpuratus clone R3-13D15, WOR... 46 3.5 1 (AC177167) Strongylocentrotus purpuratus clone R3-4015L06, W... 46 3.5 1 (AC170797) Bos taurus clone CH240-195D11, WORKING DRAFT SEQU... 46 3.5 1 (AC006872) Caenorhabditis elegans clone Y53G8Y, *** SEQUENCI... 46 3.5 1 (AY067683) Schmidtea mediterranea clone HB.6.11h unknown mRN... 46 3.5 1 (AK282624) Gryllus bimaculatus mRNA, GBcontig29485. 46 3.5 1 (AZ477784) 1M0297P06R Mouse 10kb plasmid UUGC1M library Mus ... 46 3.5 1 (CR401268) Arabidopsis thaliana T-DNA flanking sequence GK-8... 46 3.5 1 (CC140739) NDL.49L4.T7 Notre Dame Liverpool Aedes aegypti ge... 46 3.5 1 (CC126830) NDL.4H17.SP6 Notre Dame Liverpool Aedes aegypti g... 46 3.5 1 (EL514578) CHWX637.b1_I16.ab1 CHW(XYZ) silverleaf sunflower ... 46 3.5 1 (EL514410) CHWX417.b1_A09.ab1 CHW(XYZ) silverleaf sunflower ... 46 3.5 1 (EL513701) CHUY469.b1_I21.ab1 CHU(XYZ) puzzle sunflower Heli... 46 3.5 1 (EL512621) CHTY392.b1_O01.ab1 CHT(XYZ) Jerusalem artichoke H... 46 3.5 1 (EL511760) CHEY625.b1_A14.ab1 CHE(XYZ) serpentine sunflower ... 46 3.5 1 (EL511566) CHEY430.b1_K11.ab1 CHE(XYZ) serpentine sunflower ... 46 3.5 1 (EL479432) CHUM1404.b1_G16.ab1 CHU(LMS) puzzle sunflower Hel... 46 3.5 1 (EL468759) CHTS7396.b1_H01.ab1 CHT(LMS) Jerusalem artichoke ... 46 3.5 1 (EL467815) CHTS6523.b2_F24.ab1 CHT(LMS) Jerusalem artichoke ... 46 3.5 1 (EL446188) CHTM25025.b1_A17.ab1 CHT(LMS) Jerusalem artichoke... 46 3.5 1 (EL438626) CHTM13847.b1_M05.ab1 CHT(LMS) Jerusalem artichoke... 46 3.5 1 (EL429023) CHCM8248.b1_P21.ab1 CHC(LMS) Texas blueweed Helia... 46 3.5 1 (EH635165) EST6273 LK04 Laupala kohalensis cDNA clone 106102... 46 3.5 1 (EH632064) EST3171 LK04 Laupala kohalensis cDNA clone 106102... 46 3.5 1 (EE618665) CHWM5966.b1_K04.ab1 CHW(LMS) silverleaf sunflower... 46 3.5 1 (EE617128) CHWM4537.b1_B08.ab1 CHW(LMS) silverleaf sunflower... 46 3.5 1 (EE616434) CHWM3900.b1_G15.ab1 CHW(LMS) silverleaf sunflower... 46 3.5 1 (EE615000) CHWM2444.b1_H11.ab1 CHW(LMS) silverleaf sunflower... 46 3.5 1 (EE606904) CHWL2249.b1_B12.ab1 CHW(LMS) silverleaf sunflower... 46 3.5 1 (EE452968) BNBS2DCT_UP_027_E08_14MAR2005_056 Brassica napus ... 46 3.5 1 (EE108510) SCB07371 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE107443) SCB05110 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE106487) SCB02757 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE106174) SCB01964 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE105649) SCB01206 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE105527) SCB01003 Inflorescence with GA3 (VvS12) Vitis vin... 46 3.5 1 (EE105170) SBB07641 Inflorescence (VvS11) Vitis vinifera cDN... 46 3.5 1 (EE101243) S9B08965 Ripening Berries (VvS9) Vitis vinifera c... 46 3.5 1 (EE101171) S9B08740 Ripening Berries (VvS9) Vitis vinifera c... 46 3.5 1 (EE086573) S5B06249 Fruits 7-9 mm treated with GA3 (VvS5) Vi... 46 3.5 1 (EE085190) S5B04114 Fruits 7-9 mm treated with GA3 (VvS5) Vi... 46 3.5 1 (EE085072) S5B03831 Fruits 7-9 mm treated with GA3 (VvS5) Vi... 46 3.5 1 (EE079035) S2B11995 Buds (VvS2) Vitis vinifera cDNA clone S2... 46 3.5 1 (EE077719) S2B10565 Buds (VvS2) Vitis vinifera cDNA clone S2... 46 3.5 1 (EE076601) S1G05401 Fruits and flowers treated with GA3 (VvS... 46 3.5 1 (EE066225) C2B05366 Buds/little clusters (VvC2) Vitis vinife... 46 3.5 1 (EE065778) C2B03643 Buds/little clusters (VvC2) Vitis vinife... 46 3.5 1 (EE065562) C2B03484 Buds/little clusters (VvC2) Vitis vinife... 46 3.5 1 (EC936562) WIN0512.C21_N14 Cab Sauv flower, leaf and root no... 46 3.5 1 (EC935430) WIN054.C21_F06 Cab Sauv flower, leaf and root nor... 46 3.5 1 (EC920905) WIN012.BR_L04 Cab Sauv pericarp non-normalized (W... 46 3.5 1 (DY978053) CLSS11810.b1_D02.ab1 CLS(LMS) lettuce sativa Lact... 46 3.5 1 (DY975098) CLSM8788.b1_H14.ab1 CLS(LMS) lettuce sativa Lactu... 46 3.5 1 (DY974933) CLSM8619.b1_F19.ab1 CLS(LMS) lettuce sativa Lactu... 46 3.5 1 (DY963826) CLSM14061.b1_I12.ab1 CLS(LMS) lettuce sativa Lact... 46 3.5 1 (DY957411) CHPZ5280.b1_O24.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY953614) CHPY9940.b1_H14.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY953511) CHPY9833.b1_A12.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY953388) CHPY9706.b1_D03.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY953210) CHPY9520.b1_P04.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY952668) CHPY8964.b1_H09.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY952203) CHPY8485.b1_I09.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951923) CHPY8198.b1_L09.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951872) CHPY8147.b1_E21.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951572) CHPY7842.b1_D17.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951421) CHPY7687.b1_M01.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951386) CHPY7653.b1_J18.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY951349) CHPY7619.b1_F10.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY950118) CHPY611.b1_E10.ab1 CHP(XYZ) plains sunflower Heli... 46 3.5 1 (DY949922) CHPY5924.b1_H17.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY949065) CHPY4766.b1_L15.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY948925) CHPY4635.b1_E07.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY948838) CHPY4550.b1_L10.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY948104) CHPY3467.b1_E03.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY947128) CHPY2463.b1_N15.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY946469) CHPY1776.b1_O12.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY946178) CHPY14536.b1_P10.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY946015) CHPY14365.b1_J15.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY945946) CHPY14291.b1_E21.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY945838) CHPY14178.b1_D18.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY945281) CHPY13605.b1_J17.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY945099) CHPY13418.b1_D20.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY944930) CHPY13245.b1_J23.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY944898) CHPY13211.b1_F15.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY944722) CHPY13030.b1_L18.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943950) CHPY11851.b1_F12.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943925) CHPY11826.b1_D06.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943790) CHPY11685.b1_J17.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943751) CHPY11645.b1_J07.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943741) CHPY11635.b1_F05.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY943159) CHPY11024.b1_O20.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY942342) CHPY10186.b1_C04.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY942254) CHPY10097.b1_B05.ab1 CHP(XYZ) plains sunflower He... 46 3.5 1 (DY939896) CHPX6877.b1_J16.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY939573) CHPX6518.b1_L22.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY938056) CHPX4838.b1_K10.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY936686) CHPX2912.b1_O08.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY936615) CHPX2838.b1_L13.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY936307) CHPX2418.b1_D05.ab1 CHP(XYZ) plains sunflower Hel... 46 3.5 1 (DY924911) CHAY8024.b1_P14.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY924346) CHAY7469.b1_J19.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY922684) CHAY5911.b1_N13.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY921509) CHAY4822.b1_K06.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY920873) CHAY4233.b1_A03.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY920493) CHAY3877.b1_I09.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY920480) CHAY3864.b1_O05.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY920374) CHAY3758.b1_L04.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY920035) CHAY3411.b1_F14.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY919416) CHAY2772.b1_G21.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY918075) CHAY1397.b1_I14.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY918029) CHAY13795.b1_F18.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY917975) CHAY13746.b1_D06.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY917923) CHAY13698.b1_C18.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY917865) CHAY13644.b1_G04.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY917367) CHAY1318.b1_L17.ab1 CHA(XYZ) common wild sunflowe... 46 3.5 1 (DY917224) CHAY13048.b1_P22.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY916794) CHAY12634.b1_D16.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY916756) CHAY12599.b1_N06.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY916592) CHAY12448.b1_P15.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY905793) CHAX12899.b1_E10.ab1 CHA(XYZ) common wild sunflow... 46 3.5 1 (DY834051) CTOY9989.b1_I01.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY833001) CTOY8923.b1_E23.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY832657) CTOY8185.b1_B07.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY832631) CTOY8157.b1_I23.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY831942) CTOY7405.b1_J03.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY831120) CTOY6652.b1_H07.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY830156) CTOY5752.b1_P22.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY829962) CTOY5573.b1_I02.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY829806) CTOY5429.b1_I13.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY829101) CTOY478.b1_K23.ab1 CTO(XYZ) dandelion Taraxacum o... 46 3.5 1 (DY828893) CTOY4583.b1_N18.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY828864) CTOY4556.b1_H12.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY828851) CTOY4544.b1_P08.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY828758) CTOY4457.b1_A12.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY828589) CTOY4298.b1_C19.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY827936) CTOY3680.b1_O08.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY827841) CTOY3583.b1_N07.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY827618) CTOY3356.b1_G24.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY827029) CTOY2648.b1_P14.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY826944) CTOY2563.b1_E18.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY826474) CTOY2083.b1_F17.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY823903) CTOY15572.b1_G06.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY823376) CTOY15090.b1_D05.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY822917) CTOY14663.b1_M17.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY822785) CTOY14542.b1_L12.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY822756) CTOY14516.b1_H06.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY822526) CTOY14302.b1_K23.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY822310) CTOY14105.b1_A24.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY821656) CTOY13494.b1_K13.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY821378) CTOY13236.b1_H21.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY821242) CTOY13110.b1_K13.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY821110) CTOY1299.b1_F13.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY821057) CTOY12940.b1_G20.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY820821) CTOY12724.b1_G13.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY820259) CTOY12207.b1_N04.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY820203) CTOY12155.b1_E16.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY819577) CTOY11579.b1_E15.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY819296) CTOY11301.b1_J17.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY818485) CTOY10483.b1_F05.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY817591) CTOX6688.b1_P15.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY817469) CTOX6537.b1_A03.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY817235) CTOX6284.b1_H11.ab1 CTO(XYZ) dandelion Taraxacum ... 46 3.5 1 (DY813741) CTOX22494.b1_K08.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY812093) CTOX20812.b2_G19.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY811793) CTOX20501.b1_J13.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY811659) CTOX20363.b1_E03.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY811350) CTOX20053.b1_I21.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY809901) CTOX18474.b2_C11.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY805761) CTOX13917.b1_I23.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY804263) CTOX12398.b1_L03.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY804110) CTOX12249.b1_B16.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY804052) CTOX12191.b1_M24.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY802717) CTOX10838.b1_K21.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY802684) CTOX10805.b1_I13.ab1 CTO(XYZ) dandelion Taraxacum... 46 3.5 1 (DY676247) STRAT76JX cold-stressed Fragaria vesca seedlings ... 46 3.5 1 (DY669084) STRBU64JX cold-stressed Fragaria vesca seedlings ... 46 3.5 1 (DY035828) mcr02-3ms1-o06 mcr02 Mesembryanthemum crystallinu... 46 3.5 1 (DY031871) mcr02-1ms1-f09 mcr02 Mesembryanthemum crystallinu... 46 3.5 1 (DW490428) GH_RMIRS_080_E01_R Cotton Normalized Library rand... 46 3.5 1 (DW490427) GH_RMIRS_080_E01_F Cotton Normalized Library rand... 46 3.5 1 (DW169764) CLVY8057.b1_B24.ab1 CLV(XYZ) lettuce virosa Lactu... 46 3.5 1 (DW166920) CLVY5371.b1_F24.ab1 CLV(XYZ) lettuce virosa Lactu... 46 3.5 1 (DW166846) CLVY5300.b1_H06.ab1 CLV(XYZ) lettuce virosa Lactu... 46 3.5 1 (DW165442) CLVY3991.b1_N13.ab1 CLV(XYZ) lettuce virosa Lactu... 46 3.5 1 (DW154607) CLVX6684.b1_H15.ab1 CLV(XYZ) lettuce virosa Lactu... 46 3.5 1 (DW140409) CLSY8060.b1_H24.ab1 CLS(XYZ) lettuce sativa Lactu... 46 3.5 1 (DW138406) CLSY6158.b2_K03.ab1 CLS(XYZ) lettuce sativa Lactu... 46 3.5 1 (DW136768) CLSY4293.b1_I17.ab1 CLS(XYZ) lettuce sativa Lactu... 46 3.5 1 (DW134337) CLSY1825.b1_B02.ab1 CLS(XYZ) lettuce sativa Lactu... 46 3.5 1 (DW120651) CLRY9290.b1_C19.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW120464) CLRY9096.b1_O18.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW119768) CLRY8384.b2_P08.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW117965) CLRY6642.b1_D05.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW116959) CLRY5711.b1_N12.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW116621) CLRY5400.b1_O05.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW113145) CLRY1236.b1_G21.ab1 CLR(XYZ) lettuce serriola Lac... 46 3.5 1 (DW069205) CLLY9008.b1_P19.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW068083) CLLY7839.b1_N15.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW068010) CLLY7765.b1_I21.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW063394) CLLY3055.b1_N20.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW061405) CLLY13855.b1_M07.ab1 CLL(XYZ) lettuce saligna Lac... 46 3.5 1 (DW056204) CLLX8749.b1_J04.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW051697) CLLX4451.b1_E10.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DW051570) CLLX4336.b1_P03.ab1 CLL(XYZ) lettuce saligna Lact... 46 3.5 1 (DV451604) CV02007B1G11.f1 CV02-normalized library Manihot e... 46 3.5 1 (DV221748) VVI200A08_615158 CabSau Flower Stage 12 (FLOu0012... 46 3.5 1 (DT019599) VVI051B02_589038 CabSau Flower Stage 12 (FLOu0012... 46 3.5 1 (DT018078) VVI019H07_585996 CabSau Flower Stage 12 (FLOu0012... 46 3.5 1 (DR457149) CM052C01 Cotton Lambda Zap Express Library Gossyp... 46 3.5 1 (DR399888) TKN052C12_627298 Taraxacum kok-saghyz root cDNA l... 46 3.5 1 (DN802069) G.hir-15-20 DAA bolls irrigated 272 15-20 DAA bol... 46 3.5 1 (DN299391) PL04015B2E12 cDNA from sexually mature hermaphodi... 46 3.5 1 (DN293604) PL030014B10D05 cDNA from sexually mature hermapho... 46 3.5 1 (DN292626) PL030011A20E11 cDNA from sexually mature hermapho... 46 3.5 1 (DN200054) USDA-FP_138118 Citrus root weevil whole body adul... 46 3.5 1 (DC448660) Gryllus bimaculatus mRNA, clone:GBpAP012_A09, uns... 46 3.5 1 (DC446063) Gryllus bimaculatus mRNA, clone:GBpAP005_A04, uns... 46 3.5 1 (AM877001) Venerupis (Ruditapes) philippinarum EST, 5' end s... 46 3.5 1 (CV100660) FAMU_USDA_FP_8683 Vitis shuttleworthii L., grape ... 46 3.5 1 (CV100338) FAMU_USDA_FP_8361 Vitis shuttleworthii L., grape ... 46 3.5 1 (CV097075) FAMU_USDA_FP_5098 Vitis shuttleworthii L., grape ... 46 3.5 1 (CV096753) FAMU_USDA_FP_4776 Vitis shuttleworthii L., grape ... 46 3.5 1 (CV095831) FAMU_USDA_FP_3854 Vitis shuttleworthii L., grape ... 46 3.5 1 (CV095151) FAMU_USDA_FP_3174 Vitis shuttleworthii L., grape ... 46 3.5 1 (CO863158) LM_SM5_004092 Locusta migratoria solitarious phas... 46 3.5 1 (CO863157) LM_SM5_004091 Locusta migratoria solitarious phas... 46 3.5 1 (CO857222) LM_SL5_002623 Locusta migratoria solitarious phas... 46 3.5 1 (CO847152) LM_GM5_004742 Locusta migratoria gregarious phase... 46 3.5 1 (CO835530) LM_GH5_003469 Locusta migratoria gregarious phase... 46 3.5 1 (CO827598) LM_GB5_007924 Locusta migratoria gregarious phase... 46 3.5 1 (CO827597) LM_GB5_007923 Locusta migratoria gregarious phase... 46 3.5 1 (CO827596) LM_GB5_007922 Locusta migratoria gregarious phase... 46 3.5 1 (CO535479) tai03a08.y1 HyEch JUMY T1 Hydractinia echinata cD... 46 3.5 1 (CO494662) G.h.fbr-sw04052 G.h.fbr-sw Gossypium hirsutum cDN... 46 3.5 1 (CO129406) GR__Eb28D03.r GR__Eb Gossypium raimondii cDNA clo... 46 3.5 1 (CO128518) GR__Eb25F20.r GR__Eb Gossypium raimondii cDNA clo... 46 3.5 1 (CO123740) GR__Eb06B15.f GR__Eb Gossypium raimondii cDNA clo... 46 3.5 1 (CO123293) GR__Eb05F20.f GR__Eb Gossypium raimondii cDNA clo... 46 3.5 1 (CO123076) GR__Eb05A14.f GR__Eb Gossypium raimondii cDNA clo... 46 3.5 1 (CO118638) GR__Eb021B24.r GR__Eb Gossypium raimondii cDNA cl... 46 3.5 1 (CO108415) GR__Eb0040D04.r GR__Eb Gossypium raimondii cDNA c... 46 3.5 1 (CO107671) GR__Eb0039A06.r GR__Eb Gossypium raimondii cDNA c... 46 3.5 1 (CO102840) GR__Eb0030I13.r GR__Eb Gossypium raimondii cDNA c... 46 3.5 1 (CO082016) GR__Ea46G21.r GR__Ea Gossypium raimondii cDNA clo... 46 3.5 1 (CN807459) HDAH01C12.F Leech Haementeria depressa library HD... 46 3.5 1 (CN605154) USDA_FP_132254 Vitis shuttleworthii L., grape Vit... 46 3.5 1 (AJ807159) Antirrhinum majus EST, clone 018_6_05_p09. 46 3.5 1 (AJ802688) Antirrhinum majus EST, clone 018_5_04_m02. 46 3.5 1 (AJ798663) Antirrhinum majus EST, clone 018_4_05_h21. 46 3.5 1 (AJ793593) Antirrhinum majus EST, clone 018_3_02_n19. 46 3.5 1 (AJ559718) Antirrhinum majus EST, clone 018_1_11_c05. 46 3.5 1 (CF607881) GEMMA01_001410 Grape Bud pSPORT1 Library Vitis vi... 46 3.5 1 (CF214160) CGF1000813_C09 Vitis vinifera cv. cabernet sauvig... 46 3.5 1 (CF207625) CAB20002_IIIa_Fa_B11 Cabernet Sauvignon Flower bl... 46 3.5 1 (CD887675) G118.105P06F010606 G118 Triticum aestivum cDNA cl... 46 3.5 1 (CD855611) DH0AF22ZA10ZM1 HaDevR7 Helianthus annuus cDNA clo... 46 3.5 1 (CB972737) CAB30001_IVb_Fb_C10 Cabernet Sauvignon Berry Stag... 46 3.5 1 (CB972666) CAB30001_IVa_Ra_C10 Cabernet Sauvignon Berry Stag... 46 3.5 1 (CB346544) CAB2SG0002IF_A11 Cabernet Sauvignon Berry - CAB2S... 46 3.5 1 (BU012566) QGJ2E10.yg.ab1 QG_EFGHJ lettuce serriola Lactuca ... 46 3.5 1 (BQ995596) QGG10H02.yg.ab1 QG_EFGHJ lettuce serriola Lactuca... 46 3.5 1 (BQ994135) QGF6G12.yg.ab1 QG_EFGHJ lettuce serriola Lactuca ... 46 3.5 1 (BQ987190) QGF11I18.yg.ab1 QG_EFGHJ lettuce serriola Lactuca... 46 3.5 1 (BQ866375) QGC7M22.yg.ab1 QG_ABCDI lettuce salinas Lactuca s... 46 3.5 1 (BQ863570) QGC24D22.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 3.5 1 (BQ855539) QGB26O24.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 3.5 1 (BG442066) GA__Ea0015K01f Gossypium arboreum 7-10 dpa fiber ... 46 3.5 1 (BF480636) L0-2589T3 Ice plant Lambda Uni-Zap XR expression ... 46 3.5 1 (BF473708) WHE0931_D08_H15ZS Wheat 5-15 DAP spike cDNA libra... 46 3.5 1 (GE542572) CCHS28907.b1_F03.ab1 CCHS Espina Barnadesia spino... 46 3.5 1 (GE527348) CCHS14308.b1_H01.ab1 CCHS Espina Barnadesia spino... 46 3.5 1 (GE511041) CCFT7812.b1_H09.ab1 CCF(STU) sunflower Helianthus... 46 3.5 1 (GE507714) CCFT5868.b1_H03.ab1 CCF(STU) sunflower Helianthus... 46 3.5 1 (GE501663) CCFT2902.b1_K06.ab1 CCF(STU) sunflower Helianthus... 46 3.5 1 (GE495153) CCFS6874.b1_D16.ab1 CCF(STU) sunflower Helianthus... 46 3.5 1 (FF684044) RH_MEa0011cA05 RH_MEa blackberry emerging leaf Ru... 46 3.5 1 (FE883542) XYM2459.rev XYM Monosiga brevicollis rapidly grow... 46 3.5 1 (FC059132) sT7aVVM_AER19D01 VVM Vitis vinifera cDNA clone VV... 46 3.5 1 (EY109155) CAZI6118.fwd CAZI Artemisia annua normalized leaf... 46 3.5 1
>(AF073837) Dictyostelium discoideum calnexin precursor, gene, complete cds. Length = 1611
Score = 1009 bits (509), Expect(2) = 0.0 Identities = 515/517 (99%) Strand = Plus / Plus
Query: 625 agaatccaaaatgcgcctctggccaatgcggtgagtgggtcatcccaaccatcgccaacc 684 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 905 agaatccaaaatgcgcctctggccaatgcggtgagtgggtcatcccaaccatcgccaacc 964
Query: 685 cattatacaagggtaaatggtccgcaccaatggtagcaaacccattgtacaagggtgaat 744 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 965 cattatacaagggtaaatggtccgcaccaatggtagcaaacccattgtacaagggtgaat 1024
Query: 745 ggaaaccaagacaaattgcaaatccatcctatttcaacgttgagaatccatatatcgtag 804 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1025 ggaaaccaagacaaattgcaaatccatcctatttcaacgttgagaatccatatatcgtag 1084
Query: 805 agccaatcattgcagtcggtattgaagttttgtcaaatactcgtgatattctctttgata 864 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1085 agccaatcattgcagtcggtattgaagttttgtcaaatactcgtgatattctctttgata 1144
Query: 865 atttcattatcactcattctcaagaagaagctcaacaattattacaagagaattggaaag 924 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1145 atttcattatcactcattctcaagaagaagctcaacaattattacaagagaattggaaag 1204
Query: 925 agaaacatacaattcaaaaggaaagacaagcagccaaaaacgctgaagatgccaaaaaac 984 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1205 agaaacatacaattcaaaaggaaagacaagcagccaaaaacgctgaagatgccaaaaaac 1264
Query: 985 tcgacccatctcaaggtgatatctttgaaactattaaattctatttaactctcttccaat 1044 |||||||||||||||||||||||| || |||||||||||||||||||||||||||||||| Sbjct: 1265 tcgacccatctcaaggtgatatctctgcaactattaaattctatttaactctcttccaat 1324
Query: 1045 ctgaagcaaatcaaaatccattactttatttagttggtttctcttctttacttttaccaa 1104 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1325 ctgaagcaaatcaaaatccattactttatttagttggtttctcttctttacttttaccaa 1384
Query: 1105 ttgtattttgtttcactcgttcaaagaaaccatcatc 1141 ||||||||||||||||||||||||||||||||||||| Sbjct: 1385 ttgtattttgtttcactcgttcaaagaaaccatcatc 1421
Score = 264 bits (133), Expect(2) = 0.0 Identities = 133/133 (100%) Strand = Plus / Plus
Query: 1149 gttaaatctgatgatgataataattcaacctcaactaccaccaccaatacttcagtcact 1208 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1429 gttaaatctgatgatgataataattcaacctcaactaccaccaccaatacttcagtcact 1488
Query: 1209 aaagaatctgtttcaattcaagataaaccaactattgaatctgaagaatctgatgaatct 1268 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1489 aaagaatctgtttcaattcaagataaaccaactattgaatctgaagaatctgatgaatct 1548
Query: 1269 gatgaagataatg 1281 ||||||||||||| Sbjct: 1549 gatgaagataatg 1561
Score = 1033 bits (521), Expect(2) = 0.0 Identities = 524/525 (99%) Strand = Plus / Plus
Query: 90 ggagtttgtgtttcatttaatccaagtaaagatacattattttttgaagattttcaagat 149 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 43 ggagtttgtgtttcatttaatccaagtaaagatacattattttttgaagattttcaagat 102
Query: 150 ttaggtaaaagttcatcaaaatggattaaatcaagtaatcaagaatatagtggagttatt 209 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 103 ttaggtaaaagttcatcaaaatggattaaatcaagtaatcaagaatatagtggagttatt 162
Query: 210 ggatttaaagcagccaatgatccaatcgatgagaatgataatggtttagtattaacccaa 269 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 163 ggatttaaagcagccaatgatccaatcgatgagaatgataatggtttagtattaacccaa 222
Query: 270 gcaggtaaaagatatgcaatcacctatcaattaagtcacgcaattgataacaccaataaa 329 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 223 gcaggtaaaagatatgcaatcacctatcaattaagtcacgcaattgataacaccaataaa 282
Query: 330 gaattaatagttcaatatgagttacaattccaagagggtgtaacatgttcaggtggttac 389 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 283 gaattaatagttcaatatgagttacaattccaagagggtgtaacatgttcaggtggttac 342
Query: 390 attaaattgtacacagatcgtgaagatttcaatgtggaaactgtcgactcaaacacccca 449 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 343 attaaattgtacacagatcgtgaagatttcaatgtggaaactgtcgactcaaacacccca 402
Query: 450 tacagcatcatgtttggcgccgacgtttgcggaagcaatgacagaattcatttcatcgtt 509 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 403 tacagcatcatgtttggcgccgacgtttgcggaagcaatgacagaattcatttcatcgtt 462
Query: 510 cgtcatcgtaacccaatcacaaatgtacacgaagagaaattgatcactgcaaaaccatcg 569 |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| Sbjct: 463 cgtcatcgtaacccaatcacaaatgtacacgaagagaaattgatcactgcgaaaccatcg 522
Query: 570 gttagaaaagacagagtgtcgcatatctacaccttgatcatcaga 614 ||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 523 gttagaaaagacagagtgtcgcatatctacaccttgatcatcaga 567
Score = 34.2 bits (17), Expect(2) = 0.0 Identities = 20/21 (95%) Strand = Plus / Plus
Query: 1245 gaatctgaagaatctgatgaa 1265 |||||||| |||||||||||| Sbjct: 1534 gaatctgatgaatctgatgaa 1554
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 1,400,558,483 Number of extensions: 80281667 Number of successful extensions: 6562356 Number of sequences better than 10.0: 543 Length of query: 1375 Length of database: 98,766,808,389 Length adjustment: 24 Effective length of query: 1351 Effective length of database: 96,409,374,237 Effective search space: 130249064594187 Effective search space used: 130249064594187 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.16 |
Homology vs Protein |
Query= Contig-U15509-1 (Contig-U15509-1Q) /CSM_Contig/Contig-U15509-1Q.Seq.d (1375 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AB168292_1(AB168292|pid:none) Macaca fascicularis testis cDNA cl... 135 5e-30 BC057469_1(BC057469|pid:none) Danio rerio calreticulin, like 2, ... 132 2e-29 FN315559_1(FN315559|pid:none) Schistosoma japonicum isolate Anhu... 131 5e-29 FN315558_1(FN315558|pid:none) Schistosoma japonicum isolate Anhu... 130 1e-28 FN321096_1(FN321096|pid:none) Schistosoma japonicum isolate Anhu... 130 1e-28 AB218598_1(AB218598|pid:none) Solanum lycopersicum LeCNX61.0 mRN... 125 5e-27 AY036607_1(AY036607|pid:none) Brassica napus putative papillar c... 124 8e-27 AF402771_1(AF402771|pid:none) Meloidogyne incognita calreticulin... 124 1e-26 FB905270_1(FB905270|pid:none) Sequence 124543 from Patent WO2008... 122 3e-26 FB905294_1(FB905294|pid:none) Sequence 124567 from Patent WO2008... 122 4e-26 T03251(T03251) calnexin - maize (fragment) &X77569_1(X77569|pid... 121 5e-26 FB905264_1(FB905264|pid:none) Sequence 124537 from Patent WO2008... 121 5e-26 BT034146_1(BT034146|pid:none) Zea mays full-length cDNA clone ZM... 121 5e-26 BT072764_1(BT072764|pid:none) Salmo salar clone ssal-rgf-539-230... 121 7e-26 FB905300_1(FB905300|pid:none) Sequence 124573 from Patent WO2008... 121 7e-26 L24159_1(L24159|pid:none) Schistosoma mansoni calreticulin gene,... 121 7e-26 BT053022_1(BT053022|pid:none) Medicago truncatula clone MTYFL_FM... 120 9e-26 AC139708_21(AC139708|pid:none) Medicago truncatula clone mth2-9f... 120 9e-26 (Q40401) RecName: Full=Calreticulin; Flags: Precursor; &T16968(... 120 9e-26 AF457551_1(AF457551|pid:none) Anopheles gambiae calreticulin mRN... 120 9e-26 BT045076_1(BT045076|pid:none) Salmo salar clone ssal-rgf-511-130... 120 9e-26 AF195882_1(AF195882|pid:none) Danio rerio calreticulin mRNA, com... 120 9e-26 BC046699_1(BC046699|pid:none) Xenopus laevis calreticulin, mRNA ... 120 1e-25 (O82709) RecName: Full=Calnexin homolog; Flags: Precursor; &FB9... 120 1e-25 AY393845_1(AY393845|pid:none) Gallus gallus calreticulin mRNA, p... 120 1e-25 (P29402) RecName: Full=Calnexin homolog 1; Flags: Precursor; &A... 120 2e-25 BC067917_1(BC067917|pid:none) Xenopus tropicalis calreticulin, m... 120 2e-25 M80524_1(M80524|pid:none) Schistosoma japonicum calreticulin (RA... 120 2e-25 DQ535486_1(DQ535486|pid:none) Paralichthys olivaceus calreticuli... 119 3e-25 AB196933_1(AB196933|pid:none) Glycine max Gm cnx-1 mRNA for caln... 118 4e-25 S29129(S29129) calreticulin precursor (clone 3) - African clawed... 118 4e-25 JH0795(JH0795;B31409;F60977) calreticulin precursor - California... 118 6e-25 BC068336_1(BC068336|pid:none) Danio rerio calreticulin, mRNA (cD... 118 6e-25 EU984501_1(EU984501|pid:none) Nicotiana tabacum calreticulin mRN... 118 6e-25 AY342298_1(AY342298|pid:none) Ictalurus punctatus ER-resident ch... 117 7e-25 BC044068_1(BC044068|pid:none) Xenopus laevis calreticulin, mRNA ... 117 7e-25 (Q6Q487) RecName: Full=Calnexin homolog; Flags: Precursor; 117 1e-24 AY850367_1(AY850367|pid:none) Penicillium chrysogenum calreticul... 117 1e-24 (Q61KR9) RecName: Full=Calreticulin; Flags: Precursor; 117 1e-24 AY560606_1(AY560606|pid:none) Aspergillus fumigatus calnexin mRN... 116 2e-24 BC124496_1(BC124496|pid:none) Danio rerio calmegin, mRNA (cDNA c... 115 3e-24 EU886196_8(EU886196|pid:none) Beauveria bassiana strain ATCC 715... 115 4e-24 (P27798) RecName: Full=Calreticulin; Flags: Precursor; &AF12596... 115 5e-24 BX842628_14(BX842628|pid:none) Neurospora crassa DNA linkage gro... 115 5e-24 FN314644_1(FN314644|pid:none) Schistosoma japonicum isolate Anhu... 115 5e-24 AF466603_1(AF466603|pid:none) Aedes aegypti isolate AEA_CLU39 pu... 114 6e-24 BC075778_1(BC075778|pid:none) Danio rerio calreticulin like, mRN... 114 6e-24 D78589_1(D78589|pid:none) Rana rugosa mRNA for calreticulin, com... 114 6e-24 A46637(A46637) calnexin homolog SmIrV1 - fluke (Schistosoma mans... 114 6e-24 DQ497013_1(DQ497013|pid:none) Coccidioides posadasii strain Silv... 114 6e-24 AF052978_1(AF052978|pid:none) Dirofilaria immitis calreticulin p... 114 6e-24 BC046906_1(BC046906|pid:none) Danio rerio calreticulin like, mRN... 114 6e-24 FN392320_338(FN392320|pid:none) Pichia pastoris GS115 chromosome... 114 1e-23 AC141864_28(AC141864|pid:none) Medicago truncatula clone mth2-21... 113 2e-23 FN319311_1(FN319311|pid:none) Schistosoma japonicum isolate Anhu... 113 2e-23 S29130(S29130;T01068)calreticulin (clone 8) - African clawed fro... 112 3e-23 AY100687_1(AY100687|pid:none) Cricetulus griseus calnexin mRNA, ... 112 4e-23 FN319310_1(FN319310|pid:none) Schistosoma japonicum isolate Anhu... 111 7e-23 CR382128_508(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 111 7e-23 AB047037_1(AB047037|pid:none) Halocynthia roretzi HrCalnexin mRN... 110 9e-23 AF025955_1(AF025955|pid:none) Schistosoma japonicum calcium-bind... 110 9e-23 FN314643_1(FN314643|pid:none) Schistosoma japonicum isolate Anhu... 110 9e-23 (P35565) RecName: Full=Calnexin; Flags: Precursor; &C54354(C543... 110 9e-23 EU446229_1(EU446229|pid:none) Xenopus (Silurana) epitropicalis c... 110 1e-22 AE017345_68(AE017345|pid:none) Cryptococcus neoformans var. neof... 110 1e-22 BT078244_1(BT078244|pid:none) Lepeophtheirus salmonis Pacific fo... 110 2e-22 X67598_1(X67598|pid:none) X.laevis mRNA for calreticulin (clone ... 110 2e-22 BC041719_1(BC041719|pid:none) Xenopus laevis similar to calnexin... 109 2e-22 AF177915_1(AF177915|pid:none) Strongylocentrotus purpuratus calr... 109 2e-22 AB071869_1(AB071869|pid:none) Mesocricetus auratus CNX mRNA for ... 109 3e-22 (P27824) RecName: Full=Calnexin; AltName: Full=Major histocompat... 109 3e-22 AY892033_1(AY892033|pid:none) Synthetic construct Homo sapiens c... 109 3e-22 EU446230_1(EU446230|pid:none) Xenopus (Silurana) sp. new tetrapl... 109 3e-22 A37273(A37273;S17366;A45224)calnexin precursor - dog 109 3e-22 AK294702_1(AK294702|pid:none) Homo sapiens cDNA FLJ55574 complet... 109 3e-22 AJ719429_1(AJ719429|pid:none) Gallus gallus mRNA for hypothetica... 108 3e-22 CR861420_1(CR861420|pid:none) Pongo abelii mRNA; cDNA DKFZp459P0... 108 3e-22 AJ011990_1(AJ011990|pid:none) Tritrichomonas suis mRNA for calre... 108 3e-22 (Q5R440) RecName: Full=Calnexin; Flags: Precursor; 108 3e-22 BC153264_1(BC153264|pid:none) Bos taurus calnexin, mRNA (cDNA cl... 108 3e-22 (P35564) RecName: Full=Calnexin; Flags: Precursor; &AK084175_1(... 108 5e-22 L23865_1(L23865|pid:none) Mouse calnexin mRNA, partial cds. 108 5e-22 AB179155_1(AB179155|pid:none) Macaca fascicularis testis cDNA cl... 108 5e-22 AK159298_1(AK159298|pid:none) Mus musculus osteoclast-like cell ... 108 5e-22 CR860439_1(CR860439|pid:none) Pongo abelii mRNA; cDNA DKFZp459J1... 108 6e-22 AK304420_1(AK304420|pid:none) Homo sapiens cDNA FLJ54242 complet... 108 6e-22 AC079815_18(AC079815|pid:none) Trypanosoma brucei chromosome 4 c... 108 6e-22 AK129990_1(AK129990|pid:none) Homo sapiens cDNA FLJ26480 fis, cl... 108 6e-22 AM409242_1(AM409242|pid:none) Hansenula polymorpha cne1 gene for... 107 8e-22 BC044970_1(BC044970|pid:none) Xenopus laevis calnexin, mRNA (cDN... 107 8e-22 D78590_1(D78590|pid:none) Rana rugosa mRNA for calnexin, complet... 107 8e-22 BC014595_1(BC014595|pid:none) Homo sapiens calreticulin 3, mRNA ... 107 8e-22 AB090887_1(AB090887|pid:none) Bombyx mori crt mRNA for calreticu... 107 8e-22 (Q3SYT6) RecName: Full=Calmegin; Flags: Precursor; &BC103401_1(... 106 2e-21 DQ381152_1(DQ381152|pid:none) Bos taurus BTA17 39037 genomic seq... 106 2e-21 CT005268_263(CT005268|pid:none) Leishmania major strain Friedlin... 106 2e-21 BC054903_1(BC054903|pid:none) Danio rerio zgc:63524, mRNA (cDNA ... 106 2e-21 (O14967) RecName: Full=Calmegin; Flags: Precursor; &AK093096_1(... 106 2e-21 CP001323_102(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 106 2e-21 AK299243_1(AK299243|pid:none) Homo sapiens cDNA FLJ55357 complet... 106 2e-21 AY288070_1(AY288070|pid:none) Ictalurus punctatus calnexin mRNA,... 105 5e-21 AK019534_1(AK019534|pid:none) Mus musculus adult male testis cDN... 104 9e-21 X99488_1(X99488|pid:none) D.melanogaster mRNA for calnexin. 104 9e-21 AY089406_1(AY089406|pid:none) Drosophila melanogaster AT22968 fu... 104 9e-21 AB170416_1(AB170416|pid:none) Macaca fascicularis brain cDNA clo... 104 9e-21 AC159404_8(AC159404|pid:none) Trypanosoma brucei chromosome 8 cl... 104 9e-21 AE014297_4544(AE014297|pid:none) Drosophila melanogaster chromos... 103 1e-20 AE014298_1832(AE014298|pid:none) Drosophila melanogaster chromos... 103 1e-20 FJ688375_1(FJ688375|pid:none) Agaricus bisporus calnexin mRNA, c... 103 2e-20 AB172053_1(AB172053|pid:none) Macaca fascicularis brain cDNA clo... 103 2e-20 AE014298_2523(AE014298|pid:none) Drosophila melanogaster chromos... 103 2e-20 BT040696_1(BT040696|pid:none) Zea mays full-length cDNA clone ZM... 102 3e-20 AY510702_1(AY510702|pid:none) Haemonchus contortus calreticulin-... 102 4e-20 FJ196458_1(FJ196458|pid:none) Rhodnius prolixus calreticulin mRN... 100 9e-20 EF146676_1(EF146676|pid:none) Populus trichocarpa clone WS01211_... 100 9e-20 AC149080_5(AC149080|pid:none) Medicago truncatula clone mth2-75j... 100 2e-19 EF452301_1(EF452301|pid:none) Triticum aestivum calreticulin (CR... 100 2e-19 AB196794_1(AB196794|pid:none) Glycine max Gm crt-1 mRNA for calr... 100 2e-19 AP003316_20(AP003316|pid:none) Oryza sativa Japonica Group genom... 99 3e-19 AB000718_1(AB000718|pid:none) Drosophila melanogaster mRNA for c... 99 4e-19 EU441337_1(EU441337|pid:none) Xenopus borealis clone Calnexin.a ... 99 5e-19 A46164(A46164;C61002) calnexin - human (fragment) &M98452_1(M98... 97 1e-18 A48573(A48573)calreticulin autoantigen homolog precursor - fluke... 96 3e-18 FN357356_1(FN357356|pid:none) Schistosoma mansoni genome sequenc... 96 3e-18 AF009163_2(AF009163|pid:none) Leishmania major RNA polymerase II... 96 4e-18 (Q06814) RecName: Full=Calreticulin; AltName: Full=SM4 protein; ... 95 5e-18 (P11012) RecName: Full=Calreticulin; AltName: Full=RAL1 antigen;... 95 5e-18 FN315556_1(FN315556|pid:none) Schistosoma japonicum isolate Anhu... 95 7e-18 DQ216453_1(DQ216453|pid:none) Taeniopygia guttata clone 0061P001... 94 1e-17 S67659_1(S67659|pid:none) calnexin [human, melanoma cells, SK ME... 94 1e-17 (Q9STD3) RecName: Full=Calreticulin; Flags: Precursor; &AJ00076... 92 3e-17 CP000583_345(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 92 4e-17 AC147179_27(AC147179|pid:none) Medicago truncatula clone mth2-14... 91 8e-17 (Q2HWU3) RecName: Full=Calreticulin; Flags: Precursor; &(Q4R6K8... 91 1e-16 (P14211) RecName: Full=Calreticulin; AltName: Full=CRP55; AltNam... 91 1e-16 AK160197_1(AK160197|pid:none) Mus musculus 13 days embryo liver ... 91 1e-16 AK223060_1(AK223060|pid:none) Homo sapiens mRNA for calreticulin... 91 1e-16 U36937_1(U36937|pid:none) Dictyostelium discoideum calreticulin ... 91 1e-16 (P15253) RecName: Full=Calreticulin; AltName: Full=CRP55; AltNam... 91 1e-16 AM445600_2(AM445600|pid:none) Vitis vinifera contig VV78X277184.... 91 1e-16 AY836753_1(AY836753|pid:none) Triticum aestivum calreticulin-lik... 89 3e-16 AY389897_1(AY389897|pid:none) Latimeria chalumnae calreticulin m... 89 4e-16 AK104328_1(AK104328|pid:none) Oryza sativa Japonica Group cDNA c... 89 4e-16 (Q9SLY8) RecName: Full=Calreticulin; Flags: Precursor; &AK06534... 89 4e-16 BT053146_1(BT053146|pid:none) Medicago truncatula clone MTYFL_FM... 89 5e-16 AY395274_1(AY395274|pid:none) Ixodes woodi calreticulin gene, pa... 88 6e-16 AY395270_1(AY395270|pid:none) Ixodes pararicinus calreticulin ge... 88 6e-16 AK136191_1(AK136191|pid:none) Mus musculus in vitro fertilized e... 88 6e-16 AY395262_1(AY395262|pid:none) Ixodes affinis calreticulin gene, ... 88 6e-16 AY395266_1(AY395266|pid:none) Ixodes nipponensis calreticulin ge... 88 8e-16 (Q9XF98) RecName: Full=Calreticulin; Flags: Precursor; &AF13473... 88 8e-16 A32507(A32507;A28813)41K larval antigen - nematode (Onchocerca v... 88 8e-16 BC140582_1(BC140582|pid:none) Bos taurus calreticulin, mRNA (cDN... 88 8e-16 AY395268_1(AY395268|pid:none) Ixodes pavlovskyi calreticulin gen... 88 8e-16 S43376(S43376;S36801)calreticulin, brain isoform 1 - bovine 88 8e-16 AY395265_1(AY395265|pid:none) Ixodes muris calreticulin gene, co... 88 8e-16 (P52193) RecName: Full=Calreticulin; AltName: Full=CRP55; AltNam... 88 8e-16 AY395272_1(AY395272|pid:none) Ixodes ricinus calreticulin gene, ... 88 8e-16 AY395271_1(AY395271|pid:none) Ixodes persulcatus calreticulin ge... 87 1e-15 EU446232_1(EU446232|pid:none) Xenopus (Silurana) epitropicalis c... 87 1e-15 EU446234_1(EU446234|pid:none) Xenopus (Silurana) sp. new tetrapl... 87 1e-15 AY395273_1(AY395273|pid:none) Ixodes scapularis calreticulin gen... 87 1e-15 AY690335_1(AY690335|pid:none) Ixodes scapularis calreticulin mRN... 87 1e-15 (Q9ZNY3) RecName: Full=Calreticulin; Flags: Precursor; &Y09816_... 87 1e-15 L27348_1(L27348|pid:none) Hordeum vulgare calreticulin (CRH1) mR... 87 1e-15 AY389898_1(AY389898|pid:none) Protopterus dolloi calreticulin mR... 87 1e-15 AY395267_1(AY395267|pid:none) Ixodes ovatus calreticulin gene, c... 87 1e-15 EF085019_1(EF085019|pid:none) Picea sitchensis clone WS0297_I16 ... 87 2e-15 AY395247_1(AY395247|pid:none) Amblyomma brasiliense calreticulin... 87 2e-15 AY395246_1(AY395246|pid:none) Amblyomma americanum calreticulin ... 87 2e-15 AF283816_1(AF283816|pid:none) Pinus taeda calreticulin mRNA, com... 86 2e-15 GQ150476_1(GQ150476|pid:none) Steinernema feltiae strain G26 cal... 86 2e-15 AY395250_1(AY395250|pid:none) Amblyomma maculatum calreticulin g... 86 2e-15 U07708_1(U07708|pid:none) Amblyomma americanum calreticulin (crt... 86 3e-15 EU446233_1(EU446233|pid:none) Xenopus (Silurana) sp. new tetrapl... 86 3e-15 AB021259_1(AB021259|pid:none) Oryza sativa mRNA for calcium-bind... 86 4e-15 AK318734_1(AK318734|pid:none) Arabidopsis thaliana AT1G56340 mRN... 85 5e-15 EF587757_1(EF587757|pid:none) Echinococcus granulosus calreticul... 85 5e-15 AY942147_1(AY942147|pid:none) Echinococcus granulosus putative c... 85 5e-15 AK230455_1(AK230455|pid:none) Arabidopsis thaliana mRNA for hypo... 83 2e-14 AK230218_1(AK230218|pid:none) Arabidopsis thaliana mRNA for hypo... 83 2e-14 AF325720_1(AF325720|pid:none) Pennisetum ciliare calreticulin-li... 83 3e-14 EU441338_1(EU441338|pid:none) Xenopus borealis clone Calreticuli... 83 3e-14 AC133339_28(AC133339|pid:none) Oryza sativa chromosome 3 BAC OSJ... 83 3e-14 AP008207_3345(AP008207|pid:none) Oryza sativa (japonica cultivar... 82 5e-14 AF366570_1(AF366570|pid:none) Trypanosoma congolense calreticuli... 82 5e-14 AY271304_1(AY271304|pid:none) Haemaphysalis longicornis calretic... 82 6e-14 AY395252_1(AY395252|pid:none) Amblyomma scutatum calreticulin ge... 81 1e-13 X78057_1(X78057|pid:none) Z.mays CRH mRNA. 81 1e-13 AC129719_5(AC129719|pid:none) Oryza sativa (japonica cultivar-gr... 80 1e-13 BT052978_1(BT052978|pid:none) Medicago truncatula clone MTYFL_FM... 80 1e-13 DQ406803_1(DQ406803|pid:none) Arnebia euchroma calnexin mRNA, pa... 80 2e-13 AF107115_1(AF107115|pid:none) Trypanosoma cruzi calreticulin (cl... 80 2e-13 AY086745_1(AY086745|pid:none) Arabidopsis thaliana clone 27210 m... 79 4e-13 U27698_1(U27698|pid:none) Arabidopsis thaliana calreticulin (AtC... 79 4e-13 AY395259_1(AY395259|pid:none) Hyalomma anatolicum excavatum calr... 79 5e-13 BT002494_1(BT002494|pid:none) Arabidopsis thaliana calreticulin,... 79 5e-13 (O04153) RecName: Full=Calreticulin-3; Flags: Precursor; &AY056... 79 5e-13 U66345_1(U66345|pid:none) Arabidopsis thaliana calreticulin (Crt... 79 5e-13 AC003114_8(AC003114|pid:none) Arabidopsis thaliana chromosome 1 ... 78 7e-13 CP001334_48(CP001334|pid:none) Micromonas sp. RCC299 chromosome ... 78 7e-13 AF019376_1(AF019376|pid:none) Brassica napus calreticulin mRNA, ... 78 7e-13 U49191_1(U49191|pid:none) Leishmania donovani calreticulin gene,... 78 9e-13 AM502249_328(AM502249|pid:none) Leishmania infantum chromosome 31. 77 1e-12 EU723848_1(EU723848|pid:none) Leishmania donovani strain Dd8 cal... 77 1e-12 EF084103_1(EF084103|pid:none) Picea sitchensis clone WS0274_F04 ... 76 2e-12 BC107102_1(BC107102|pid:none) Homo sapiens cDNA clone IMAGE:4001... 75 4e-12 AY271303_1(AY271303|pid:none) Rhipicephalus sanguineus calreticu... 75 4e-12 AK304492_1(AK304492|pid:none) Homo sapiens cDNA FLJ58668 complet... 75 4e-12 AY395253_1(AY395253|pid:none) Boophilus annulatus calreticulin g... 75 4e-12 AY395258_1(AY395258|pid:none) Dermacentor variabilis calreticuli... 75 6e-12 AF420211_1(AF420211|pid:none) Boophilus microplus calreticulin p... 75 6e-12 AY395254_1(AY395254|pid:none) Boophilus microplus calreticulin g... 75 6e-12 AK295230_1(AK295230|pid:none) Homo sapiens cDNA FLJ53009 complet... 75 6e-12 AY395261_1(AY395261|pid:none) Haemaphysalis leporispalustris cal... 75 7e-12 AY395256_1(AY395256|pid:none) Dermacentor andersoni calreticulin... 74 9e-12 AY271306_1(AY271306|pid:none) Dermacentor variabilis calreticuli... 74 9e-12 EU360890_1(EU360890|pid:none) Wuchereria bancrofti calreticulin ... 73 2e-11 U66344_1(U66344|pid:none) Arabidopsis thaliana calreticulin (Crt... 69 5e-10 AY810787_1(AY810787|pid:none) Schistosoma japonicum clone SJCHGC... 67 1e-09 AK230182_1(AK230182|pid:none) Arabidopsis thaliana mRNA for calr... 67 2e-09 AY826917_1(AY826917|pid:none) Heterocapsa triquetra clone HTCAL1... 67 2e-09 AF083699_1(AF083699|pid:none) Arabidopsis thaliana clone sps206 ... 64 1e-08 AL627103_4(AL627103|pid:none) Mouse DNA sequence from clone RP23... 63 2e-08 (P27825) RecName: Full=Calnexin homolog; Flags: Precursor; &AY6... 62 6e-08 AF380341_1(AF380341|pid:none) Mesocricetus auratus calnexin-like... 60 1e-07 DQ268737_1(DQ268737|pid:none) Dendrobium hybrid cultivar clone D... 57 2e-06 AB026251_1(AB026251|pid:none) Lithospermum erythrorhizon mRNA fo... 55 5e-06 CS258372_1(CS258372|pid:none) Sequence 55 from Patent EP1571221. 52 7e-05 CR380950_5(CR380950|pid:none) Candida glabrata strain CBS138 chr... 51 9e-05 EU970209_1(EU970209|pid:none) Zea mays clone 342227 unknown mRNA. 51 1e-04 CS258374_1(CS258374|pid:none) Sequence 57 from Patent EP1571221. 49 3e-04 AF398143_1(AF398143|pid:none) Brassica rapa subsp. pekinensis ca... 47 0.002 AK302149_1(AK302149|pid:none) Homo sapiens cDNA FLJ54199 complet... 45 0.005 AX884288_1(AX884288|pid:none) Sequence 151 from Patent EP1033401... 44 0.011 AK046081_1(AK046081|pid:none) Mus musculus adult male corpora qu... 44 0.014 BT070556_1(BT070556|pid:none) Picea sitchensis clone WS02735_O06... 39 0.44 AX298141_1(AX298141|pid:none) Sequence 7 from Patent WO0183789. 38 0.75 (A2RIP3) RecName: Full=UvrABC system protein B; Short=P... 37 1.3 (Q9CI06) RecName: Full=UvrABC system protein B; Short=P... 37 1.3 (Q9P7D0) RecName: Full=Uncharacterized protein P4H10.19c; Flags:... 37 2.2 AM473534_1(AM473534|pid:none) Vitis vinifera contig VV78X205423.... 37 2.2 (Q031G7) RecName: Full=UvrABC system protein B; Short=P... 36 3.7 (Q54LC8) RecName: Full=Conserved oligomeric Golgi complex subuni... 35 4.9 EF147184_1(EF147184|pid:none) Populus trichocarpa clone WS01228_... 35 4.9 DQ399530_1(DQ399530|pid:none) Arabidopsis thaliana kinesin POK2 ... 35 6.4 CP000241_1465(CP000241|pid:none) Helicobacter pylori HPAG1, comp... 35 6.4
>AB168292_1(AB168292|pid:none) Macaca fascicularis testis cDNA clone: QtsA-11027, similar to human calmegin (CLGN), mRNA, RefSeq: NM_004362.1. Length = 541
Score = 135 bits (339), Expect = 5e-30 Identities = 93/273 (34%), Positives = 127/273 (46%), Gaps = 45/273 (16%) Frame = +3
Query: 246 DNGLVLTQAGKRYAITYQLSHAIDNTNKELIVQYELQFQEGVTCSGGYIKLYTDREDFNV 425 D GLVL K +AI+ L+ +K LIVQYE+ FQ+G+ C G YIKL D +D + Sbjct: 108 DRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLIL 167
Query: 426 ETVDSNTPYSIMFGADVCGSNDRIHFIVRHRNPITNVHEEKLITAKP---SVRK---DRV 587 E T Y IMFG D CG + ++HFI RH++P T V EEK AKP ++K DR Sbjct: 168 ENFYDRTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEK--HAKPPDVDLKKFFTDRK 225
Query: 588 SHIYTLII------RXXXXNPKCASGQCGEWVIPTIANPL--------------YKGKWS 707 +H+YTL++ G E V+P I P + K Sbjct: 226 THLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPINPPKEIEDPSDKKPEEWDERAKIP 285
Query: 708 APMVANPLYKGEWKPRQ-------------------IANPSYFNVENPYIVEPIIAVGIE 830 P P E +P Q I NP YF ++P+++ A+G+E Sbjct: 286 DPSAVKPEDWDESEPAQIEDSSAVKPAGWLDDEPKFIPNPDYFEDDHPFLLTSFSALGLE 345
Query: 831 VLSNTRDILFDNFIITHSQEEAQQLLQENWKEK 929 + S T DI FDNFII +E A + W+ K Sbjct: 346 LWSMTSDIYFDNFIICSEKEVADHWAADGWRWK 378
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,910,883,469 Number of extensions: 38891522 Number of successful extensions: 111714 Number of sequences better than 10.0: 247 Number of HSP's gapped: 110748 Number of HSP's successfully gapped: 455 Length of query: 458 Length of database: 1,051,180,864 Length adjustment: 132 Effective length of query: 326 Effective length of database: 623,955,076 Effective search space: 203409354776 Effective search space used: 203409354776 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
1 |
AH (FL, L) |
0 |
AF (FL, S) |
2 |
SL (DIR, L) |
2 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
1 |
CH (FL, L) |
1 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
1 |
FC-IC (SUB) |
0 |