Contig-U03221-1
Contig ID Contig-U03221-1
Contig update 2001. 8.29
Contig sequence
>Contig-U03221-1 (Contig-U03221-1Q) /CSM_Contig/Contig-U03221-1Q.Seq.d
ACACAGACATACTTAATATAAATATAATAATAATTAAAATTTTAAATGGA
AGAAAATAAAATAACAAAACCATATTTAGTATTTATATTTTCTGGTCAAG
GTTCATTTAAAAATAAAATACCATTAGAATTATTTGAAAATGGAAATAAT
TTTAAATCAACGATAATGGAAATTGATAATATTTTTAATGAAAAATATTA
TGGATATTCAATGTTTGATAAATATAAAAATCTTAAAGAGAATGATAGTG
ATTCATTTCTAGAACAACATTTTATTCATTGTATATCATTTATGTTTCAA
GTTTCAATTTTTAAACTTTATAAACATTATGGTGTAAAACCAGATCAAAT
AGTTGGTATGAGTTTAGGAGAGATTGCTTCAGCTTATTGTTCAGGTTTAA
TCGATTTGGAAACCGCTTGTTTCATTTCCCATAAAAGAGCATGTTTAATG
ACAAAACTTGAAAATAAAACAATAAAGAAAATAATATCCATTAAAAAACC
TGAAGATTATTATTGGGATTTTATTAAACCAAATTATCCATCAATTCAAA
TTTGTGGTTGTTTATGCTATGATTTAATATTGGTGGCTGGTGATCAAAAA
TGAAATCGATCAATTAATTTGTTATTTATCTAAAAATGAAATCCGATTTC
ATTGTATTGAAGGTTTAATTAATTTTCATACATCAGATATCGATCCAGTT
GAAAATGATTTTAAACAATTATCATTTCAATCATTTGAACCTGAAATTCC
AAATATATCATGTTCAACTGCAAAATTATATAATAAGAAAACTCAAGATT
TTAATGCAGAATTTCTTTTTCATATTGCTCGTTCTCCAGTTAATCTAGGT
AAAGTAACAAATCAAATCTATGAAACTAATAGTTGTTTAAATGTAAATAG
ACCAATTGTTTTGGTTGAAATATCACCTTTTATTTTTTCATTAATACCAG
TTGAAAAAGATATTAAAAAACTTTCAAAAGAAAATAATGACAATTGTAAT
CATCAATTTTTCACTGCAATTTCTCAAGATTTTAAAACTAATTTTTTAAA
GTCTAATGATTTGTTAATTAAAACATTTGGAAAAATTAAATAAAAAAGTA
GCTTATC

Gap no gap
Contig length 1107
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 6116595
End point 6115488
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 2
Link to clone list U03221
List of clone(s)

est1=CFF428E,1,1101
est2=SSF578E,23,1108
Translated Amino Acid sequence
tqtyli*i***lkf*MEENKITKPYLVFIFSGQGSFKNKIPLELFENGNNFKSTIMEIDN
IFNEKYYGYSMFDKYKNLKENDSDSFLEQHFIHCISFMFQVSIFKLYKHYGVKPDQIVGM
SLGEIASAYCSGLIDLETACFISHKRACLMTKLENKTIKKIISIKKPEDYYWDFIKPNYP
SIQICGCLCYDLILVAGDQK*nrsinllfi*k*npisly*rfn*fsyiryrss*k*f*ti
iisii*t*nskyimfnckii**ensrf*crisfsycsfss*sr*snksnl*n**lfkck*
tncfg*nitfyffints*kry*ktfkrk**ql*ssifhcnfsrf*n*ffkv**fvn*niw
kn*ikk*li


Translated Amino Acid sequence (All Frames)
Frame A:
tqtyli*i***lkf*MEENKITKPYLVFIFSGQGSFKNKIPLELFENGNNFKSTIMEIDN
IFNEKYYGYSMFDKYKNLKENDSDSFLEQHFIHCISFMFQVSIFKLYKHYGVKPDQIVGM
SLGEIASAYCSGLIDLETACFISHKRACLMTKLENKTIKKIISIKKPEDYYWDFIKPNYP
SIQICGCLCYDLILVAGDQK*nrsinllfi*k*npisly*rfn*fsyiryrss*k*f*ti
iisii*t*nskyimfnckii**ensrf*crisfsycsfss*sr*snksnl*n**lfkck*
tncfg*nitfyffints*kry*ktfkrk**ql*ssifhcnfsrf*n*ffkv**fvn*niw
kn*ikk*li


Frame B:
hrht*ykynnn*nfkwkkik*qnhi*ylyflvkvhlkikyh*nylkmeiilnqr*wklii
flmknimdiqclinikilkrmivihf*nnilfivyhlcfkfqflnfinimv*nqik*lv*
v*erllqlivqv*siwkplvsfpikehv**qnlkikq*rk*yplknlkiiigillnqiih
qfkfvvvyami*ywwlvikneidqlicylskneirfhcieglinfhtsdidpvendfkql
sfqsfepeipniscstaklynkktqdfnaeflfhiarspvnlgkvtnqiyetnsclnvnr
pivlveispfifslipvekdikklskenndncnhqfftaisqdfktnflksndlliktfg
kik*kssl


Frame C:
tdilniniiiikilngrk*nnktifsiyifwsrfi*k*ntirii*kwk*f*indngn**y
f**kilwifnv**i*ks*re***fisrttfyslyiiyvssfnf*tl*tlwcktrsnswye
frrdcfsllfrfnrfgnrlfhfp*ksmfndkt*k*nnkennih*kt*rlllgfy*tklsi
nsnlwlfml*fniggw*skmksin*fviylkmksdfivlkv*lifihqisiqlkmilnny
hfnhlnlkfqiyhvqlqnyiirklkilmqnfffillvlqli*vk*qiksmklivv*m*id
qlfwlkyhllffh*yqlkkilknfqkkimtiviinfslqflkilklif*slmic*lkhle
klnkkvay


own update 2004. 6. 9
Homology vs CSM-cDNA
Query= Contig-U03221-1 (Contig-U03221-1Q)
/CSM_Contig/Contig-U03221-1Q.Seq.d
(1107 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U03221-1 (Contig-U03221-1Q) /CSM_Contig/Conti... 1154 0.0
Contig-U05518-1 (Contig-U05518-1Q) /CSM_Contig/Conti... 46 8e-05
Contig-U11470-1 (Contig-U11470-1Q) /CSM_Contig/Conti... 42 0.001
Contig-U06223-1 (Contig-U06223-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U12865-1 (Contig-U12865-1Q) /CSM_Contig/Conti... 38 0.020
Contig-U10558-1 (Contig-U10558-1Q) /CSM_Contig/Conti... 38 0.020
Contig-U10373-1 (Contig-U10373-1Q) /CSM_Contig/Conti... 38 0.020
Contig-U13381-1 (Contig-U13381-1Q) /CSM_Contig/Conti... 36 0.078
Contig-U12538-1 (Contig-U12538-1Q) /CSM_Contig/Conti... 36 0.078
Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Conti... 36 0.078

>Contig-U03221-1 (Contig-U03221-1Q) /CSM_Contig/Contig-U03221-1Q.Seq.d
Length = 1107

Score = 1154 bits (582), Expect = 0.0
Identities = 582/582 (100%)
Strand = Plus / Plus


Query: 499 cctgaagattattattgggattttattaaaccaaattatccatcaattcaaatttgtggt 558
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 499 cctgaagattattattgggattttattaaaccaaattatccatcaattcaaatttgtggt 558


Query: 559 tgtttatgctatgatttaatattggtggctggtgatcaaaaatgaaatcgatcaattaat 618
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 559 tgtttatgctatgatttaatattggtggctggtgatcaaaaatgaaatcgatcaattaat 618


Query: 619 ttgttatttatctaaaaatgaaatccgatttcattgtattgaaggtttaattaattttca 678
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 619 ttgttatttatctaaaaatgaaatccgatttcattgtattgaaggtttaattaattttca 678


Query: 679 tacatcagatatcgatccagttgaaaatgattttaaacaattatcatttcaatcatttga 738
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 679 tacatcagatatcgatccagttgaaaatgattttaaacaattatcatttcaatcatttga 738


Query: 739 acctgaaattccaaatatatcatgttcaactgcaaaattatataataagaaaactcaaga 798
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 739 acctgaaattccaaatatatcatgttcaactgcaaaattatataataagaaaactcaaga 798


Query: 799 ttttaatgcagaatttctttttcatattgctcgttctccagttaatctaggtaaagtaac 858
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 799 ttttaatgcagaatttctttttcatattgctcgttctccagttaatctaggtaaagtaac 858


Query: 859 aaatcaaatctatgaaactaatagttgtttaaatgtaaatagaccaattgttttggttga 918
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 859 aaatcaaatctatgaaactaatagttgtttaaatgtaaatagaccaattgttttggttga 918


Query: 919 aatatcaccttttattttttcattaataccagttgaaaaagatattaaaaaactttcaaa 978
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 919 aatatcaccttttattttttcattaataccagttgaaaaagatattaaaaaactttcaaa 978


Query: 979 agaaaataatgacaattgtaatcatcaatttttcactgcaatttctcaagattttaaaac 1038
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 979 agaaaataatgacaattgtaatcatcaatttttcactgcaatttctcaagattttaaaac 1038


Query: 1039 taattttttaaagtctaatgatttgttaattaaaacatttgg 1080
||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1039 taattttttaaagtctaatgatttgttaattaaaacatttgg 1080


Score = 765 bits (386), Expect = 0.0
Identities = 386/386 (100%)
Strand = Plus / Plus


Query: 65 caaaaccatatttagtatttatattttctggtcaaggttcatttaaaaataaaataccat 124
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65 caaaaccatatttagtatttatattttctggtcaaggttcatttaaaaataaaataccat 124


Query: 125 tagaattatttgaaaatggaaataattttaaatcaacgataatggaaattgataatattt 184
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 125 tagaattatttgaaaatggaaataattttaaatcaacgataatggaaattgataatattt 184


Query: 185 ttaatgaaaaatattatggatattcaatgtttgataaatataaaaatcttaaagagaatg 244
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 ttaatgaaaaatattatggatattcaatgtttgataaatataaaaatcttaaagagaatg 244


Query: 245 atagtgattcatttctagaacaacattttattcattgtatatcatttatgtttcaagttt 304
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 245 atagtgattcatttctagaacaacattttattcattgtatatcatttatgtttcaagttt 304


Query: 305 caatttttaaactttataaacattatggtgtaaaaccagatcaaatagttggtatgagtt 364
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 305 caatttttaaactttataaacattatggtgtaaaaccagatcaaatagttggtatgagtt 364


Query: 365 taggagagattgcttcagcttattgttcaggtttaatcgatttggaaaccgcttgtttca 424
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 365 taggagagattgcttcagcttattgttcaggtttaatcgatttggaaaccgcttgtttca 424


Query: 425 tttcccataaaagagcatgtttaatg 450
||||||||||||||||||||||||||
Sbjct: 425 tttcccataaaagagcatgtttaatg 450


Score = 36.2 bits (18), Expect = 0.078
Identities = 24/26 (92%)
Strand = Plus / Minus


Query: 176 ataatatttttaatgaaaaatattat 201
||||||||||| || |||||||||||
Sbjct: 201 ataatatttttcattaaaaatattat 176


>Contig-U05518-1 (Contig-U05518-1Q) /CSM_Contig/Contig-U05518-1Q.Seq.d
Length = 1182

Score = 46.1 bits (23), Expect = 8e-05
Identities = 26/27 (96%)
Strand = Plus / Plus


Query: 192 aaaatattatggatattcaatgtttga 218
|||||||||||| ||||||||||||||
Sbjct: 168 aaaatattatggttattcaatgtttga 194


>Contig-U11470-1 (Contig-U11470-1Q) /CSM_Contig/Contig-U11470-1Q.Seq.d
Length = 1411

Score = 42.1 bits (21), Expect = 0.001
Identities = 21/21 (100%)
Strand = Plus / Plus


Query: 303 ttcaatttttaaactttataa 323
|||||||||||||||||||||
Sbjct: 565 ttcaatttttaaactttataa 585


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 30,648
Number of Sequences: 6905
Number of extensions: 30648
Number of successful extensions: 3207
Number of sequences better than 10.0: 341
length of query: 1107
length of database: 5,674,871
effective HSP length: 16
effective length of query: 1091
effective length of database: 5,564,391
effective search space: 6070750581
effective search space used: 6070750581
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 5.28
Homology vs DNA
Query= Contig-U03221-1 (Contig-U03221-1Q) /CSM_Contig/Contig-U03221-1Q.Seq.d
(1107 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ372117) Dictyostelium discoideum cDNA clone:ddc11h08, 3' ... 708 0.0 4
(C93034) Dictyostelium discoideum slug cDNA, clone SSF578. 708 0.0 3
(BJ358778) Dictyostelium discoideum cDNA clone:ddc11h08, 5' ... 759 0.0 1
(AU072964) Dictyostelium discoideum slug cDNA, clone SSF578. 383 e-101 1
(CP001056) Clostridium botulinum B str. Eklund 17B, complete... 40 6e-04 18
(CP001158) Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisu... 34 6e-04 14
(CP000962) Clostridium botulinum A3 str. Loch Maree, complet... 38 0.007 18
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 38 0.008 19
(BX296527) Zebrafish DNA sequence from clone DKEYP-32C3 in l... 38 0.008 8
(AE017263) Mesoplasma florum L1 complete genome. 40 0.012 18
(AL928724) Zebrafish DNA sequence from clone CH211-51K14 in ... 38 0.015 9
(BA000021) Wigglesworthia glossinidia endosymbiont of Glossi... 34 0.017 19
(AF250284) Amsacta moorei entomopoxvirus, complete genome. 32 0.024 14
(AM452250) Vitis vinifera contig VV78X051161.7, whole genome... 40 0.028 3
(AL929352) Plasmodium falciparum strain 3D7, chromosome 5, s... 32 0.038 15
(AC154282) Mus musculus BAC clone RP24-273O7 from chromosome... 36 0.046 9
(AG127995) Pan troglodytes DNA, clone: PTB-139A10.F. 52 0.047 1
(AP003088) Staphylococcus aureus TY4, ETB plasmid DNA, compl... 34 0.067 7
(AL049184) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 36 0.069 12
(CP000361) Arcobacter butzleri RM4018, complete genome. 38 0.080 18
(AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 32 0.095 10
(FB571381) Sequence 248 from Patent EP1865317. 36 0.10 9
(FB571325) Sequence 192 from Patent EP1865317. 36 0.10 9
(AE014828) Plasmodium falciparum 3D7 chromosome 14 section 1... 34 0.11 14
(EJ066128) 1095458041019 Global-Ocean-Sampling_GS-26-01-01-1... 36 0.14 2
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 32 0.14 12
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 0.16 17
(AP007892) Lotus japonicus genomic DNA, chromosome 5, clone:... 40 0.17 7
(DD153408) ISOLATED HUMAN TRANSPORTER PROTEINS, NUCLEIC ACID... 50 0.18 1
(AX411767) Sequence 3 from Patent WO0224748. 50 0.18 1
(GC697994) Sequence 13239 from patent US 6812339. 50 0.18 1
(GC697627) Sequence 12872 from patent US 6812339. 50 0.18 1
(AL133279) Human chromosome 14 DNA sequence BAC R-753D20 of ... 50 0.18 1
(AP000927) Homo sapiens genomic DNA, chromosome 18p11.3 clon... 50 0.18 1
(AL122021) Human chromosome 14 DNA sequence *** IN PROGRESS ... 50 0.18 1
(CZ543282) SRAA-aad49b06.b1 Strongyloides ratti whole genome... 50 0.18 1
(AC020647) Homo sapiens 12 BAC RP11-922O23 (Roswell Park Can... 46 0.18 8
(AC182227) Bos taurus clone CH240-388G2, WORKING DRAFT SEQUE... 42 0.23 3
(AC021982) Homo sapiens clone RP11-1E5, WORKING DRAFT SEQUEN... 34 0.23 8
(AL929357) Plasmodium falciparum strain 3D7, chromosome 9; s... 38 0.23 15
(AC147538) Medicago truncatula clone mth2-135c7, complete se... 48 0.24 5
(AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 34 0.25 12
(AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 34 0.26 13
(CU457396) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 0.27 9
(FB571359) Sequence 226 from Patent EP1865317. 34 0.27 12
(FB571303) Sequence 170 from Patent EP1865317. 34 0.27 12
(AP008170) Lotus japonicus genomic DNA, chromosome 5, clone:... 40 0.30 7
(AC174713) Bos taurus clone CH240-75H19, WORKING DRAFT SEQUE... 36 0.32 8
(DD010735) Diagnosis of known genetic Parameters within the ... 36 0.35 13
(AC215453) Solanum lycopersicum chromosome 2 clone C02SLe003... 38 0.35 9
(AC024676) Homo sapiens chromosome 4 clone RP11-751H12 map 4... 46 0.36 6
(DQ366713) Uncultured Prochlorococcus marinus clone ASNC1430... 42 0.39 4
(AL844509) Plasmodium falciparum chromosome 13. 40 0.39 15
(AI680355) tw80h06.x1 NCI_CGAP_Ut3 Homo sapiens cDNA clone I... 38 0.39 2
(AC159639) Mus musculus BAC clone RP24-79M15 from chromosome... 36 0.40 2
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.47 18
(AC096420) Rattus norvegicus clone CH230-17H24, *** SEQUENCI... 38 0.50 9
(AM468324) Vitis vinifera contig VV78X149395.17, whole genom... 44 0.50 3
(U43145) Plasmodium chabaudi repeat organellar protein gene,... 30 0.50 6
(CP000382) Clostridium novyi NT, complete genome. 34 0.52 18
(AC216702) Solanum lycopersicum chromosome 7 clone C07SLm009... 40 0.55 5
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 36 0.55 15
(AF067936) Caenorhabditis elegans cosmid C24G6, complete seq... 44 0.56 3
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 38 0.57 12
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 30 0.61 14
(AJ010592) Guillardia theta DNA for complete sequence of nuc... 36 0.61 10
(AC116920) Dictyostelium discoideum chromosome 2 map 4415041... 32 0.61 9
(AL627168) Zebrafish DNA sequence from clone RP71-1M12 in li... 32 0.63 9
(Z72522) Human DNA sequence from clone LL0XNC01-231B4 on chr... 42 0.68 3
(AM478272) Vitis vinifera, whole genome shotgun sequence, co... 40 0.72 4
(AP008983) Clostridium phage c-st genomic DNA, complete genome. 36 0.72 10
(AC167785) Glycine max clone gmw2-2o24, WORKING DRAFT SEQUEN... 38 0.72 11
(CP000736) Staphylococcus aureus subsp. aureus JH1, complete... 34 0.72 20
(CP000703) Staphylococcus aureus subsp. aureus JH9, complete... 34 0.72 20
(AC141110) Medicago truncatula clone mth2-17i10, complete se... 48 0.73 1
(AC126012) Medicago truncatula clone mth2-27p4, complete seq... 48 0.73 1
(CQ613544) Sequence 41302 from Patent WO0171042. 48 0.73 1
(BD344296) Novel protein participating stress response via a... 48 0.73 1
(BD341943) New protein, mediating stress responses through a... 48 0.73 1
(AE014297) Drosophila melanogaster chromosome 3R, complete s... 48 0.73 1
(AC007813) Drosophila melanogaster, chromosome 3R, region 91... 48 0.73 1
(AC007812) Drosophila melanogaster, chromosome 3R, region 91... 48 0.73 1
(AC112484) Homo sapiens 3 BAC RP11-723O4 (Roswell Park Cance... 48 0.73 1
(AC119355) Rattus norvegicus clone CH230-475F15, *** SEQUENC... 48 0.73 1
(AC107199) Rattus norvegicus clone CH230-195F4, *** SEQUENCI... 48 0.73 1
(AC225499) Medicago truncatula clone mth2-50o16, WORKING DRA... 48 0.73 1
(AC017381) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 48 0.73 1
(EK122541) 1092964602640 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.73 1
(EK061972) 1092960092542 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.73 1
(EK056766) 1092960031102 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.73 1
(CC225606) CH261-57B19_RM1.1 CH261 Gallus gallus genomic clo... 48 0.73 1
(CA524313) KS12036A09 KS12 Capsicum annuum cDNA, mRNA sequence. 48 0.73 1
(FE344273) CAOF4899.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE344272) CAOF4899.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE343900) CAOF4641.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE343899) CAOF4641.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE343285) CAOF4219.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE343284) CAOF4219.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE342696) CAOF3851.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE342695) CAOF3851.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE342632) CAOF3804.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE342631) CAOF3804.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE341215) CAOF2808.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE341214) CAOF2808.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE340152) CAOF2085.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE340151) CAOF2085.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE340148) CAOF2082.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE340147) CAOF2082.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE339045) CAOF1340.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE339044) CAOF1340.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE338980) CAOF1291.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE338979) CAOF1291.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE338902) CAOF1235.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE338901) CAOF1235.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 48 0.73 1
(FE330517) CANZ611.fwd CANZ_Daphnia_pulex_Log50_Library_19 D... 48 0.73 1
(FE330516) CANZ611.rev CANZ_Daphnia_pulex_Log50_Library_19 D... 48 0.73 1
(FE330350) CANZ472.fwd CANZ_Daphnia_pulex_Log50_Library_19 D... 48 0.73 1
(FE330349) CANZ472.rev CANZ_Daphnia_pulex_Log50_Library_19 D... 48 0.73 1
(FE291513) CANN1063.fwd CANN_Daphnia_pulex_Log50_Library_17 ... 48 0.73 1
(FE291512) CANN1063.rev CANN_Daphnia_pulex_Log50_Library_17 ... 48 0.73 1
(DU741744) APKI862.g2 HF70_10-07-02 uncultured marine microo... 42 0.74 2
(AL592044) Human DNA sequence from clone RP13-407F1 on chrom... 44 0.74 8
(EJ276777) 1095366024746 Global-Ocean-Sampling_GS-27-01-01-1... 46 0.79 2
(AZ541774) ENTGT20TF Entamoeba histolytica Sheared DNA Entam... 44 0.81 2
(AC116330) Dictyostelium discoideum chromosome 2 map 3191214... 32 0.81 9
(AC198849) Spermophilus tridecemlineatus clone VMRC20-474A15... 40 0.86 4
(DD010736) Diagnosis of known genetic Parameters within the ... 34 0.89 13
(AC181586) Bos taurus clone CH240-37L10, WORKING DRAFT SEQUE... 44 0.95 4
(BA000016) Clostridium perfringens str. 13 DNA, complete gen... 36 1.0 21
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 36 1.0 19
(AC173978) Strongylocentrotus purpuratus clone R3-3071O10, W... 40 1.0 6
(AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 32 1.2 14
(AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 36 1.2 14
(BX548251) Zebrafish DNA sequence from clone BUSM1-127I14. 36 1.2 7
(AC004688) Plasmodium falciparum chromosome 12 clone PFYAC69... 36 1.2 9
(CU695269) Brassica rapa subsp. pekinensis clone KBrB076K20,... 34 1.3 9
(AE014831) Plasmodium falciparum 3D7 chromosome 10 section 3... 36 1.3 13
(AE016826) Buchnera aphidicola str. Bp (Baizongia pistaciae)... 34 1.4 15
(AC163914) Bos taurus clone CH240-98A23, WORKING DRAFT SEQUE... 32 1.4 10
(CP000881) Hemiselmis andersenii chromosome 1, complete sequ... 38 1.5 10
(BX004817) Zebrafish DNA sequence from clone DKEY-169B7 in l... 36 1.5 6
(AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 38 1.5 10
(CR318585) Zebrafish DNA sequence from clone CH211-153H7 in ... 36 1.5 7
(AZ529135) ENTCC12TR Entamoeba histolytica Sheared DNA Entam... 38 1.5 3
(AC172851) Bos taurus clone CH240-264O24, WORKING DRAFT SEQU... 36 1.5 7
(AE014818) Plasmodium falciparum 3D7 chromosome 14 section 3... 36 1.5 9
(AE014848) Plasmodium falciparum 3D7 chromosome 12, section ... 42 1.6 12
(AZ531021) ENTBD19TR Entamoeba histolytica Sheared DNA Entam... 38 1.7 3
(BH162781) ENTRS92TF Entamoeba histolytica Sheared DNA Entam... 38 1.7 3
(FP089534) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 38 1.7 6
(AZ549186) ENTFM54TF Entamoeba histolytica Sheared DNA Entam... 38 1.8 3
(AM485982) Vitis vinifera contig VV78X189594.5, whole genome... 34 1.8 2
(AE014850) Plasmodium falciparum 3D7 chromosome 12, section ... 36 1.8 10
(FP067395) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 32 1.8 9
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 32 1.9 13
(AM448706) Vitis vinifera contig VV78X041424.2, whole genome... 44 1.9 2
(GF016777) pRRL2:Newb:20080411:39669 USMARC Pig Breed SNP Di... 30 1.9 3
(CU463848) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 1.9 6
(AC015615) Homo sapiens clone RP11-45H8, WORKING DRAFT SEQUE... 44 2.0 3
(CZ923766) 1098415920036 CHORI-243 Ovis aries genomic clone ... 32 2.0 2
(EG765231) EST_ssal_sjb_3029 ssalsjb mixed_tissue Salmo sala... 32 2.0 2
(AC126602) Ciona savignyi clone -4791857N6, *** SEQUENCING I... 42 2.0 3
(CP000312) Clostridium perfringens SM101, complete genome. 36 2.0 19
(DY709751) EST_ssal_rgb2_65490 ssalrgb2 mixed_tissue Salmo s... 32 2.0 2
(DY717982) EST_ssal_rgb2_73721 ssalrgb2 mixed_tissue Salmo s... 32 2.0 2
(DU444806) 1098421142837 CHORI-243 Ovis aries genomic clone ... 32 2.0 2
(CB504112) ssalema003095 gut Salmo salar cDNA, mRNA sequence. 32 2.0 2
(CU407256) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 40 2.0 8
(CP000678) Methanobrevibacter smithii ATCC 35061, complete g... 36 2.1 17
(CS468864) Sequence 55 from Patent EP1748080. 34 2.2 12
(CS419341) Sequence 55 from Patent WO2006094836. 34 2.2 12
(AF538053) Monosiga brevicollis mitochondrion, complete genome. 34 2.2 9
(AC198061) Pan troglodytes BAC clone CH251-503J1 from chromo... 38 2.3 8
(CS468863) Sequence 54 from Patent EP1748080. 34 2.4 11
(CS419340) Sequence 54 from Patent WO2006094836. 34 2.4 11
(AC004157) Plasmodium falciparum chromosome 12 clone PFYAC29... 42 2.4 11
(BX120006) Zebrafish DNA sequence from clone DKEYP-21H4 in l... 36 2.4 8
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 34 2.5 14
(AC093007) Homo sapiens chromosome 3 clone RP11-593G9, WORKI... 36 2.5 7
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 32 2.5 12
(CR788233) Zebrafish DNA sequence from clone CH211-273D2 in ... 38 2.5 4
(FH149601) CHO_OF3048xn15f1.ab1 CHO_OF3 Nicotiana tabacum ge... 42 2.6 2
(AJ938182) Staphylococcus aureus RF122 complete genome. 34 2.6 19
(AC174454) Bos taurus clone CH240-93L13, WORKING DRAFT SEQUE... 38 2.8 7
(AC021856) Homo sapiens BAC clone RP11-553E5 from 4, complet... 36 2.8 8
(FH096216) CHO_OF3022xo11r1.ab1 CHO_OF3 Nicotiana tabacum ge... 42 2.8 2
(CV849077) ID0AEE7BD09RM1 ID0AEE Acyrthosiphon pisum cDNA cl... 40 2.8 2
(BX324116) Zebrafish DNA sequence from clone CH211-114G7 in ... 32 2.8 10
(CU571079) Zebrafish DNA sequence from clone CH73-386O14 in ... 46 2.9 1
(CR383684) Zebrafish DNA sequence from clone DKEYP-69E1 in l... 46 2.9 1
(AC120136) Mus musculus chromosome 1, clone RP23-277E3, comp... 46 2.9 1
(AC115846) Mus musculus chromosome 1, clone RP24-245O4, comp... 46 2.9 1
(AC145879) Pan troglodytes BAC clone RP43-20K4 from chromoso... 46 2.9 1
(AP008208) Oryza sativa (japonica cultivar-group) genomic DN... 46 2.9 1
(AP005067) Oryza sativa Japonica Group genomic DNA, chromoso... 46 2.9 1
(AP005065) Oryza sativa Japonica Group genomic DNA, chromoso... 46 2.9 1
(AM445021) Vitis vinifera contig VV78X166320.3, whole genome... 46 2.9 1
(AM430358) Vitis vinifera contig VV78X164448.23, whole genom... 46 2.9 1
(AE017343) Cryptococcus neoformans var. neoformans JEC21 chr... 46 2.9 1
(AC007045) Arabidopsis thaliana chromosome 2 clone F23M2 map... 46 2.9 1
(CQ349999) Sequence 24093 from Patent WO0157275. 46 2.9 1
(CQ337398) Sequence 11492 from Patent WO0157275. 46 2.9 1
(CQ275573) Sequence 23834 from Patent WO0157277. 46 2.9 1
(CQ263121) Sequence 11382 from Patent WO0157277. 46 2.9 1
(CQ237945) Sequence 24784 from Patent WO0157273. 46 2.9 1
(CQ225101) Sequence 11940 from Patent WO0157273. 46 2.9 1
(CQ187216) Sequence 18612 from Patent WO0157274. 46 2.9 1
(CQ177402) Sequence 8798 from Patent WO0157274. 46 2.9 1
(CQ154697) Sequence 24719 from Patent WO0157276. 46 2.9 1
(CQ141814) Sequence 11836 from Patent WO0157276. 46 2.9 1
(CQ115929) Sequence 24788 from Patent WO0157272. 46 2.9 1
(CQ102939) Sequence 11798 from Patent WO0157272. 46 2.9 1
(CQ081377) Sequence 17177 from Patent WO0157278. 46 2.9 1
(CQ072241) Sequence 8041 from Patent WO0157278. 46 2.9 1
(AC084197) Caenorhabditis elegans cosmid Y73B6BL, complete s... 46 2.9 1
(AC093461) Homo sapiens BAC clone RP11-764P14 from 7, comple... 46 2.9 1
(AC063956) Homo sapiens 4 BAC RP11-529K3 (Roswell Park Cance... 46 2.9 1
(AC152780) Bos taurus clone CH240-3P5, WORKING DRAFT SEQUENC... 46 2.9 1
(AC141003) Rattus norvegicus clone CH230-526I15, *** SEQUENC... 46 2.9 1
(AC114726) Rattus norvegicus clone CH230-97M6, WORKING DRAFT... 46 2.9 1
(AC114092) Rattus norvegicus clone CH230-90C24, *** SEQUENCI... 46 2.9 1
(AC096185) Rattus norvegicus clone CH230-11G1, *** SEQUENCIN... 46 2.9 1
(FP016243) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 2.9 1
(AC079850) Homo sapiens chromosome 12 clone RP11-761C24, ***... 46 2.9 1
(AC220544) Bos taurus clone CH240-354O17, WORKING DRAFT SEQU... 46 2.9 1
(AC207545) Zea mays chromosome 5 clone CH201-454M10; ZMMBBc0... 46 2.9 1
(AC006898) Caenorhabditis elegans clone Y73B6x, *** SEQUENCI... 46 2.9 1
(BH185250) 026_P_08-rev SmBAC1 Schistosoma mansoni genomic c... 46 2.9 1
(EK306941) 1095462384005 Global-Ocean-Sampling_GS-31-01-01-1... 46 2.9 1
(AQ077967) CIT-HSP-2366I8.TF CIT-HSP Homo sapiens genomic cl... 46 2.9 1
(AL622200) T3 end of clone 026DH04 of library SmBAC1 from st... 46 2.9 1
(EJ545798) 1092956086279 Global-Ocean-Sampling_GS-29-01-01-1... 46 2.9 1
(EJ515526) 1092955086447 Global-Ocean-Sampling_GS-29-01-01-1... 46 2.9 1
(EJ048698) 1095454133282 Global-Ocean-Sampling_GS-26-01-01-1... 46 2.9 1
(EI463023) PV_GBa0067F04.f PV_GBa Phaseolus vulgaris genomic... 46 2.9 1
(DU780292) ASXB3141.b2 HF500_10-06-02 uncultured marine micr... 46 2.9 1
(CW400618) fsbb001f091a11f0 Sorghum methylation filtered lib... 46 2.9 1
(CW156057) 104_558_11146472_148_36365_018 Sorghum methylatio... 46 2.9 1
(AG760174) Macaca fuscata fuscata DNA, clone: MSB2-229B01_R,... 46 2.9 1
(CG262858) OG2BZ82TH ZM_0.7_1.5_KB Zea mays genomic clone ZM... 46 2.9 1
(BX986687) Reverse strand read from insert in 3'HPRT inserti... 46 2.9 1
(AU074496) Dictyostelium discoideum slug cDNA, clone SSL129. 46 2.9 1
(CF662777) CcLX05a16m16f1 Carp mixed tissue library 2 Cyprin... 46 2.9 1
(FE926572) NPAE-aaa28h07.b2 N.brasiliensis_NPAE1_EST_L3A Nip... 46 2.9 1
(EY351767) CAWZ18290.rev CAWZ Helobdella robusta Primary Lat... 46 2.9 1
(CP001185) Thermosipho africanus TCF52B, complete genome. 46 2.9 1
(AC090794) Homo sapiens chromosome 8 clone RP11-267J1 map 8,... 38 2.9 5
(AC189444) Brassica rapa subsp. pekinensis clone KBrB070J23,... 34 2.9 9
(AC123565) Homo sapiens 3 BAC RP11-539J20 (Roswell Park Canc... 36 3.0 6
(AC185013) Bos taurus clone CH240-263M17, WORKING DRAFT SEQU... 32 3.0 9
(EJ928613) 1093018794165 Global-Ocean-Sampling_GS-30-02-01-1... 36 3.0 2
(CU633225) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 3.0 7
(AP000607) Arabidopsis thaliana genomic DNA, chromosome 5, B... 36 3.1 5
(AC022751) Homo sapiens clone RP11-198I7, WORKING DRAFT SEQU... 38 3.1 8
(DQ927303) Tetrahymena malaccensis strain MP75 mitochondrion... 32 3.1 9
(AC146288) Danio rerio clone CH211-47G6, WORKING DRAFT SEQUE... 36 3.2 6
(AC210387) Populus trichocarpa clone POP105-B09, complete se... 38 3.3 5
(AC164678) Bos taurus clone CH240-98A19, WORKING DRAFT SEQUE... 32 3.5 9
(ES401671) MUT04-M07.y1d-s SHGC-MUT Mytilus californianus cD... 44 3.5 2
(AC177508) Strongylocentrotus purpuratus clone R3-1027I15, W... 36 3.5 3
(DU344464) 1098313090724 CHORI-243 Ovis aries genomic clone ... 34 3.6 3
(BX571857) Staphylococcus aureus strain MSSA476, complete ge... 34 3.6 18
(AE014846) Plasmodium falciparum 3D7 chromosome 12, section ... 34 3.8 13
(AL445564) Mycoplasma pulmonis (strain UAB CTIP) complete ge... 32 3.8 11
(AL928692) Zebrafish DNA sequence from clone CH211-208D15 in... 36 3.8 8
(AC201478) Strongylocentrotus purpuratus clone R3-3055D10, W... 34 3.9 6
(AC141713) Apis mellifera clone CH224-56H1, *** SEQUENCING I... 36 3.9 6
(AC174142) Medicago truncatula clone mth2-69j4, complete seq... 36 4.0 7
(CU582781) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 38 4.1 6
(BD061520) Genome DNA of symbiotic bacteria of aphid. 36 4.1 14
(AR409405) Sequence 1 from patent US 6632935. 36 4.1 14
(BA000003) Buchnera aphidicola str. APS (Acyrthosiphon pisum... 36 4.1 14
(AC181895) Strongylocentrotus purpuratus clone R3-1016C20, W... 36 4.2 5
(CP001161) Buchnera aphidicola str. 5A (Acyrthosiphon pisum)... 36 4.2 14
(AC103908) Canis lupus familiaris clone RP81-414C11, WORKING... 38 4.2 7
(AE014839) Plasmodium falciparum 3D7 chromosome 11 section 4... 36 4.3 12
(AE014849) Plasmodium falciparum 3D7 chromosome 12, section ... 32 4.3 12
(AM285304) Spiroplasma citri GII3-3X chromosome, contig Cont... 30 4.3 13
(AC215898) Populus trichocarpa clone POP041-L02, complete se... 38 4.4 8
(CT573253) Zebrafish DNA sequence from clone CH211-127N13 in... 40 4.4 6
(AM427129) Vitis vinifera contig VV78X215731.7, whole genome... 40 4.4 3
(AP008934) Staphylococcus saprophyticus subsp. saprophyticus... 32 4.5 2
(ER846937) PPTCN10TF Solanum tuberosum RHPOTKEY BAC ends Sol... 40 4.5 2
(AE014820) Plasmodium falciparum 3D7 chromosome 14 section 5... 38 4.6 7
(GC700145) Sequence 15390 from patent US 6812339. 44 4.6 5
(AE017197) Rickettsia typhi str. Wilmington complete genome. 32 4.7 20
(Z97348) Plasmodium falciparum MAL3P1. 30 4.8 8
(AY352277) Apis mellifera complementary sex determiner (csd)... 34 4.8 6
(AE014836) Plasmodium falciparum 3D7 chromosome 11 section 1... 36 4.9 10
(BX511194) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 38 5.0 7
(DC226499) Plasmodium berghei strain ANKA cDNA clone:SG00602... 38 5.0 2
(AM477939) Vitis vinifera contig VV78X113375.3, whole genome... 36 5.1 4
(EJ570340) 1092960033587 Global-Ocean-Sampling_GS-29-01-01-1... 34 5.1 3
(DC229668) Plasmodium berghei strain ANKA cDNA clone:SG01625... 38 5.2 2
(EA048112) Sequence 3 from patent US 7154021. 32 5.2 11
(EA048111) Sequence 2 from patent US 7154021. 32 5.2 11
(AX196296) Sequence 3 from Patent WO0151627. 32 5.2 11
(AX196295) Sequence 2 from Patent WO0151627. 32 5.2 11
(GP062385) Sequence 3 from patent US 7485770. 32 5.2 11
(GP062384) Sequence 2 from patent US 7485770. 32 5.2 11
(AE014833) Plasmodium falciparum 3D7 chromosome 10 section 5... 34 5.2 11
(CR955008) Medicago truncatula chromosome 5 clone mte1-51b2,... 44 5.2 4
(AC202376) Medicago truncatula clone mth2-97e21, complete se... 32 5.2 7
(CN575696) rc57e07.x1 Meloidogyne hapla egg pAMP1 v1 Meloido... 36 5.4 2
(AC230691) Bos taurus clone CH240-501P13, WORKING DRAFT SEQU... 30 5.4 10
(BI399452) MI-P-AY1-nrg-f-04-0-UI.s1 MI-P-AY1 Sus scrofa cDN... 36 5.4 2
(AL627261) Zebrafish DNA sequence from clone RP71-1N11 in li... 32 5.5 2
(AC114319) Homo sapiens chromosome 5 clone RP11-456H14, WORK... 36 5.5 10
(CU062561) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 5.5 6
(AC216952) Solanum tuberosum chromosome 6 clone RHPOTKEY147M... 34 5.5 2
(DC232092) Plasmodium berghei strain ANKA cDNA clone:SG02379... 38 5.6 2
(BX088654) Zebrafish DNA sequence from clone CH211-195H6 in ... 38 5.6 7
(EJ164481) 1092344060272 Global-Ocean-Sampling_GS-27-01-01-1... 30 5.7 4
(AP010455) Lotus japonicus genomic DNA, chromosome 3, clone:... 30 5.7 7
(DC230814) Plasmodium berghei strain ANKA cDNA clone:SG01986... 38 5.7 2
(BX530069) Zebrafish DNA sequence from clone DKEY-22L17 in l... 34 5.8 9
(AC069003) Homo sapiens chromosome 17 clone RP11-213B3, WORK... 40 5.8 7
(CU628000) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 5.9 6
(AC097504) Homo sapiens BAC clone RP11-362F19 from 4, comple... 34 5.9 9
(AF015262) Homo sapiens chromosome 21 clone Pac 255P7 map 21... 34 6.0 6
(CT963107) Medicago truncatula chromosome 5 clone mte1-34b22... 36 6.0 7
(AM434887) Vitis vinifera contig VV79X002900.2, whole genome... 34 6.0 2
(AC229953) Mustela putorius furo clone CH237-521H21, WORKING... 36 6.0 7
(CR382400) Plasmodium falciparum chromosome 6, complete sequ... 34 6.0 14
(AM433881) Vitis vinifera contig VV78X160939.8, whole genome... 38 6.1 2
(AL929202) Zebrafish DNA sequence from clone DKEY-147L19 in ... 36 6.1 6
(BB973398) Plasmodium berghei str. ANKA cDNA clone: OK003177... 38 6.1 2
(CU928265) H.melpomene DNA sequence from clone AEHM-18H13. 34 6.1 8
(CR384086) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 6.1 7
(DD230996) GENE PRODUCTS DIFFERENTIALLY EXPRESSED IN CANCERO... 34 6.2 2
(CP000001) Bacillus cereus E33L, complete genome. 40 6.3 23
(AC095168) Rattus norvegicus clone CH230-8L12, *** SEQUENCIN... 34 6.3 5
(AC022655) Homo sapiens, clone RP11-28O3, complete sequence. 34 6.3 6
(DC232329) Plasmodium berghei strain ANKA cDNA clone:SG02448... 38 6.3 2
(CP000727) Clostridium botulinum A str. Hall, complete genome. 34 6.3 19
(DC224771) Plasmodium berghei strain ANKA cDNA clone:SG00081... 38 6.4 2
(EJ372207) 1092963728303 Global-Ocean-Sampling_GS-28-01-01-1... 34 6.4 3
(AP006628) Onion yellows phytoplasma OY-M DNA, complete genome. 36 6.5 17
(AE015927) Clostridium tetani E88, complete genome. 36 6.7 20
(DC234781) Plasmodium berghei strain ANKA cDNA clone:SG03138... 38 6.7 2
(DC232296) Plasmodium berghei strain ANKA cDNA clone:SG02438... 38 6.8 2
(CP000246) Clostridium perfringens ATCC 13124, complete genome. 36 6.8 20
(AX344565) Sequence 16 from Patent WO0200932. 34 6.9 11
(CP001267) Borrelia burgdorferi 156a plasmid 156a_lp38, comp... 32 6.9 5
(DC234271) Plasmodium berghei strain ANKA cDNA clone:SG02993... 38 6.9 2
(AC150579) Bos taurus clone CH240-260N12, WORKING DRAFT SEQU... 32 6.9 9
(AC115684) Dictyostelium discoideum chromosome 2 map 3108975... 32 7.0 6
(AC214468) Populus trichocarpa clone POP038-L21, complete se... 38 7.0 8
(DC234272) Plasmodium berghei strain ANKA cDNA clone:SG02993... 38 7.0 2
(DC234957) Plasmodium berghei strain ANKA cDNA clone:SG03175... 38 7.0 2
(BX629345) Zebrafish DNA sequence from clone DKEY-148A13 in ... 32 7.0 7
(DB298426) Homo sapiens cDNA clone BRACE3001240, 3' end, mRN... 34 7.0 2
(DC233661) Plasmodium berghei strain ANKA cDNA clone:SG02832... 38 7.1 2
(CF143040) UI-HF-BR0p-aqy-a-02-0-UI.r1 NIH_MGC_52 Homo sapie... 34 7.1 2
(EK382172) 1095469466211 Global-Ocean-Sampling_GS-31-01-01-1... 34 7.2 2
(BH151759) ENTPU53TF Entamoeba histolytica Sheared DNA Entam... 32 7.2 2
(DC225505) Plasmodium berghei strain ANKA cDNA clone:SG00295... 38 7.2 2
(AZ548158) ENTDG18TF Entamoeba histolytica Sheared DNA Entam... 32 7.2 2
(AZ535904) ENTDB34TF Entamoeba histolytica Sheared DNA Entam... 32 7.2 2
(AZ530022) ENTCA10TR Entamoeba histolytica Sheared DNA Entam... 32 7.2 2
(EK009488) 1092955150862 Global-Ocean-Sampling_GS-31-01-01-1... 32 7.2 2
(CS623759) Sequence 310 from Patent WO2006071466. 38 7.2 2
(AZ668813) ENTGY55TF Entamoeba histolytica Sheared DNA Entam... 32 7.3 2
(DC226452) Plasmodium berghei strain ANKA cDNA clone:SG00585... 38 7.3 2
(AZ689056) ENTHJ86TF Entamoeba histolytica Sheared DNA Entam... 32 7.3 2
(ET752333) CHO_OF311xl13f1.ab1 CHO_OF Nicotiana tabacum geno... 32 7.3 2
(EK404699) 1095479007181 Global-Ocean-Sampling_GS-31-01-01-1... 34 7.3 2
(DC235199) Plasmodium berghei strain ANKA cDNA clone:SG03225... 38 7.3 2
(CR382398) Plasmodium falciparum chromosome 6, complete sequ... 32 7.3 13
(AW182816) xj64c01.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA ... 34 7.4 2
(AC169100) Bos taurus clone CH240-216N18, WORKING DRAFT SEQU... 44 7.4 4
(EJ901330) 1093018491795 Global-Ocean-Sampling_GS-30-02-01-1... 32 7.4 2
(BM692611) UI-E-CL1-afe-g-21-0-UI.r1 UI-E-CL1 Homo sapiens c... 34 7.5 2
(AC224075) Bos taurus clone CH240-451A14, WORKING DRAFT SEQU... 34 7.5 5
(AE015450) Mycoplasma gallisepticum strain R complete genome. 32 7.5 20
(EF506945) Leptosira terrestris UTEX 333 chloroplast, comple... 38 7.5 10
(AG252380) Lotus japonicus DNA, clone:LjT31n14_sfi. 42 7.5 2
(AX344566) Sequence 17 from Patent WO0200932. 34 7.6 12
(AJ416708) Populus deltoides MER locus, genomic DNA, cultiva... 32 7.6 9
(DC233719) Plasmodium berghei strain ANKA cDNA clone:SG02851... 38 7.7 2
(DC231203) Plasmodium berghei strain ANKA cDNA clone:SG02114... 38 7.7 2
(DC235185) Plasmodium berghei strain ANKA cDNA clone:SG03221... 38 7.7 2
(AF083031) Guillardia theta nucleomorph chromosome 3, comple... 30 7.7 11
(DC232568) Plasmodium berghei strain ANKA cDNA clone:SG02520... 38 7.8 2
(DD230997) GENE PRODUCTS DIFFERENTIALLY EXPRESSED IN CANCERO... 34 7.8 2
(DC227416) Plasmodium berghei strain ANKA cDNA clone:SG00885... 38 7.8 2
(AC179604) Strongylocentrotus purpuratus clone R3-1029A14, W... 34 7.9 7
(DC227769) Plasmodium berghei strain ANKA cDNA clone:SG01006... 38 7.9 2
(CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 30 8.0 16
(DC230701) Plasmodium berghei strain ANKA cDNA clone:SG01948... 38 8.0 2
(DC224609) Plasmodium berghei strain ANKA cDNA clone:SG00035... 38 8.0 2
(AJ430679) Saccharomyces servazzii complete mitochondrial ge... 38 8.1 4
(DC231875) Plasmodium berghei strain ANKA cDNA clone:SG02318... 38 8.1 2
(DC226507) Plasmodium berghei strain ANKA cDNA clone:SG00605... 38 8.2 2
(DC226105) Plasmodium berghei strain ANKA cDNA clone:SG00475... 38 8.2 2
(BM663826) UI-E-CL1-afe-g-21-0-UI.s1 UI-E-CL1 Homo sapiens c... 34 8.3 2
(DC228977) Plasmodium berghei strain ANKA cDNA clone:SG01406... 38 8.3 2
(BM975082) UI-CF-EC1-acf-n-15-0-UI.s1 UI-CF-EC1 Homo sapiens... 34 8.3 2
(DC227426) Plasmodium berghei strain ANKA cDNA clone:SG00889... 38 8.3 2
(DC230889) Plasmodium berghei strain ANKA cDNA clone:SG02012... 38 8.4 2
(AC157763) Pan troglodytes BAC clone CH251-340C15 from chrom... 44 8.4 5
(DC225508) Plasmodium berghei strain ANKA cDNA clone:SG00296... 38 8.4 2
(AL354829) Human DNA sequence from clone RP11-218B22 on chro... 38 8.5 6
(AC126793) Medicago truncatula chromosome 8 clone mth2-17m16... 32 8.5 7
(GN009507) Sequence 1948 from Patent EP2014669. 38 8.5 7
(DC226325) Plasmodium berghei strain ANKA cDNA clone:SG00544... 38 8.6 2
(AC127021) Medicago truncatula clone mth2-5e5, complete sequ... 34 8.6 9
(CR847565) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 32 8.7 10
(DC226030) Plasmodium berghei strain ANKA cDNA clone:SG00449... 38 8.8 2
(Z30974) Caenorhabditis elegans Cosmid K08E5. 38 8.9 5
(AL844507) Plasmodium falciparum chromosome 8. 36 8.9 13
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 32 9.0 14
(AC224930) Bos taurus clone CH240-472F21, WORKING DRAFT SEQU... 38 9.0 6
(AM442603) Vitis vinifera contig VV78X097961.2, whole genome... 32 9.0 4
(CT573077) Medicago truncatula chromosome 5 clone mth2-43j18... 44 9.3 7
(DC229531) Plasmodium berghei strain ANKA cDNA clone:SG01577... 38 9.3 2
(DX105448) MUGQ_CH252P020G01Sp6_GL333_009 CHORI-252 Vervet M... 34 9.3 3
(AM487115) Vitis vinifera contig VV78X049544.5, whole genome... 32 9.3 5
(DC200656) Plasmodium berghei cDNA clone:LV013109, liver sta... 38 9.3 2
(EG709261) nbm14b11.y1 Cow lens. Unnormalized (nbm) Bos taur... 42 9.5 2
(AL953843) Zebrafish DNA sequence from clone DKEY-42P8 in li... 36 9.5 6
(BA000033) Staphylococcus aureus subsp. aureus MW2 DNA, comp... 34 9.6 18
(AC196761) Citrus sinensis clone CSRBBa-042G02, WORKING DRAF... 34 9.7 5
(AJ831474) Pisum sativum promoter region and partial pa2 gen... 32 9.7 4
(FH931640) CHO_NF2026xj04f1.ab1 CHO_NF2 Nicotiana tabacum ge... 36 9.8 2
(AC004710) Plasmodium falciparum chromosome 12, *** SEQUENCI... 36 9.9 8
(ER865282) PPTCV45TR Solanum tuberosum RHPOTKEY BAC ends Sol... 40 9.9 2

>(BJ372117) Dictyostelium discoideum cDNA clone:ddc11h08, 3' end,
single read.
Length = 682

Score = 708 bits (357), Expect(4) = 0.0
Identities = 357/357 (100%)
Strand = Plus / Minus


Query: 597 aaaatgaaatcgatcaattaatttgttatttatctaaaaatgaaatccgatttcattgta 656
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 503 aaaatgaaatcgatcaattaatttgttatttatctaaaaatgaaatccgatttcattgta 444


Query: 657 ttgaaggtttaattaattttcatacatcagatatcgatccagttgaaaatgattttaaac 716
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 443 ttgaaggtttaattaattttcatacatcagatatcgatccagttgaaaatgattttaaac 384


Query: 717 aattatcatttcaatcatttgaacctgaaattccaaatatatcatgttcaactgcaaaat 776
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 383 aattatcatttcaatcatttgaacctgaaattccaaatatatcatgttcaactgcaaaat 324


Query: 777 tatataataagaaaactcaagattttaatgcagaatttctttttcatattgctcgttctc 836
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 323 tatataataagaaaactcaagattttaatgcagaatttctttttcatattgctcgttctc 264


Query: 837 cagttaatctaggtaaagtaacaaatcaaatctatgaaactaatagttgtttaaatgtaa 896
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 263 cagttaatctaggtaaagtaacaaatcaaatctatgaaactaatagttgtttaaatgtaa 204


Query: 897 atagaccaattgttttggttgaaatatcaccttttattttttcattaataccagttg 953
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 203 atagaccaattgttttggttgaaatatcaccttttattttttcattaataccagttg 147

Score = 200 bits (101), Expect(4) = 0.0
Identities = 101/101 (100%)
Strand = Plus / Minus


Query: 499 cctgaagattattattgggattttattaaaccaaattatccatcaattcaaatttgtggt 558
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 600 cctgaagattattattgggattttattaaaccaaattatccatcaattcaaatttgtggt 541


Query: 559 tgtttatgctatgatttaatattggtggctggtgatcaaaa 599
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 540 tgtttatgctatgatttaatattggtggctggtgatcaaaa 500

Score = 87.7 bits (44), Expect(4) = 0.0
Identities = 44/44 (100%)
Strand = Plus / Minus


Query: 985 taatgacaattgtaatcatcaatttttcactgcaatttctcaag 1028
||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 115 taatgacaattgtaatcatcaatttttcactgcaatttctcaag 72

Score = 71.9 bits (36), Expect(4) = 0.0
Identities = 36/36 (100%)
Strand = Plus / Minus


Query: 417 ttgtttcatttcccataaaagagcatgtttaatgac 452
||||||||||||||||||||||||||||||||||||
Sbjct: 682 ttgtttcatttcccataaaagagcatgtttaatgac 647

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 1,496,528,629
Number of extensions: 106472514
Number of successful extensions: 9558971
Number of sequences better than 10.0: 430
Length of query: 1107
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 1083
Effective length of database: 99,340,224,878
Effective search space: 107585463542874
Effective search space used: 107585463542874
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.27
Homology vs Protein
Query= Contig-U03221-1 (Contig-U03221-1Q) /CSM_Contig/Contig-U03221-1Q.Seq.d
(1107 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q54KU3) RecName: Full=Probable polyketide synthase 25; ... 115 8e-35
(Q54KU5) RecName: Full=Probable polyketide synthase 24; ... 115 1e-34
(B0G0Z9) RecName: Full=Probable polyketide synthase 6; ... 116 5e-34
AC116982_20(AC116982|pid:none) Dictyostelium discoideum chromoso... 116 5e-34
AC117176_58(AC117176|pid:none) Dictyostelium discoideum chromoso... 112 7e-34
(Q559A9) RecName: Full=Probable polyketide synthase 13; ... 112 7e-34
(B0G101) RecName: Full=Probable polyketide synthase 8/35; ... 114 7e-34
(B0G100) RecName: Full=Probable polyketide synthase 7; ... 112 3e-33
AC116982_23(AC116982|pid:none) Dictyostelium discoideum chromoso... 112 3e-33
(Q54ED6) RecName: Full=Probable polyketide synthase 41; ... 110 2e-30
(Q55DM7) RecName: Full=Probable polyketide synthase 2; ... 116 4e-30
(Q54QD1) RecName: Full=Probable polyketide synthase 23; ... 115 2e-28
(Q54TW0) RecName: Full=Probable polyketide synthase 18; ... 101 4e-27
(Q54B49) RecName: Full=Probable polyketide synthase 45; ... 107 7e-27
(Q558W4) RecName: Full=Probable polyketide synthase 15; ... 113 1e-23
AC117075_22(AC117075|pid:none) Dictyostelium discoideum chromoso... 113 1e-23
(B0G103) RecName: Full=Probable polyketide synthase 10; ... 109 2e-22
AC116982_72(AC116982|pid:none) Dictyostelium discoideum chromoso... 109 2e-22
(Q558Y6) RecName: Full=Probable polyketide synthase 14; ... 107 6e-22
(Q54FC8) RecName: Full=Probable polyketide synthase 39; ... 107 8e-22
(Q54FD2) RecName: Full=Probable polyketide synthase 38; ... 106 1e-21
AC116982_28(AC116982|pid:none) Dictyostelium discoideum chromoso... 106 2e-21
(Q54FN7) RecName: Full=Probable polyketide synthase 33; ... 106 2e-21
(Q54FQ3) RecName: Full=Probable polyketide synthase 29; ... 105 2e-21
(B0G170) RecName: Full=Probable polyketide synthase 28; ... 102 2e-20
(Q54G30) RecName: Full=Probable polyketide synthase 27; ... 102 2e-20
AC116963_16(AC116963|pid:none) Dictyostelium discoideum chromoso... 99 2e-19
(Q55E72) RecName: Full=Probable polyketide synthase 1; ... 89 3e-16
(Q869W9) RecName: Full=Probable polyketide synthase 16; ... 78 6e-13
BX005238_11(BX005238|pid:none) Zebrafish DNA sequence from clone... 77 1e-12
AL935186_8(AL935186|pid:none) Zebrafish DNA sequence from clone ... 77 1e-12
(Q869X2) RecName: Full=Probable polyketide synthase 17; ... 73 2e-11
CP000875_1864(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 72 4e-11
AY495620_1(AY495620|pid:none) Botryotinia fuckeliana polyketide ... 54 2e-10
AF188287_5(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 70 2e-10
AL009126_1768(AL009126|pid:none) Bacillus subtilis subsp. subtil... 69 2e-10
AF188287_2(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 69 3e-10
BA000045_1954(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 69 4e-10
AM270096_3(AM270096|pid:none) Aspergillus niger contig An04c0360... 68 7e-10
AM420293_2531(AM420293|pid:none) Saccharopolyspora erythraea NRR... 65 3e-09
AF521085_12(AF521085|pid:none) Streptomyces nanchangensis NS3226... 65 3e-09
AF521085_13(AF521085|pid:none) Streptomyces nanchangensis NS3226... 65 3e-09
AY495617_1(AY495617|pid:none) Botryotinia fuckeliana polyketide ... 65 3e-09
AY150178_1(AY150178|pid:none) Exophiala lecanii-corni polyketide... 65 4e-09
CP001037_2811(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 64 7e-09
AC2012(AC2012) hypothetical protein all1649 [imported] - Nostoc ... 64 7e-09
AP008957_221(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 64 1e-08
AJ557546_10(AJ557546|pid:none) Melittangium lichenicola melithia... 64 1e-08
AP009552_2780(AP009552|pid:none) Microcystis aeruginosa NIES-843... 64 1e-08
CP000393_3333(CP000393|pid:none) Trichodesmium erythraeum IMS101... 63 2e-08
AM179409_3(AM179409|pid:none) Chondromyces crocatus chondramide ... 63 2e-08
AM420293_2550(AM420293|pid:none) Saccharopolyspora erythraea NRR... 63 2e-08
DQ272520_4(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 63 2e-08
CP000113_3836(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 63 2e-08
FJ477836_6(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 56 2e-08
CP000875_2400(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 62 3e-08
CP000113_4409(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 62 3e-08
AY652953_7(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 62 3e-08
AM988861_6(AM988861|pid:none) Chondromyces crocatus chondrochlor... 62 4e-08
AJ698723_1(AJ698723|pid:none) Stigmatella aurantiaca myxochromid... 62 5e-08
BA000045_2829(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 62 5e-08
T30225(T30225) polyketide synthase - Streptomyces hygroscopicus ... 62 5e-08
CP000875_3940(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 61 6e-08
CP000384_4992(CP000384|pid:none) Mycobacterium sp. MCS, complete... 61 6e-08
FJ872523_17(FJ872523|pid:none) Streptomyces sp. DSM 21069 putati... 61 6e-08
AE005176_773(AE005176|pid:none) Lactococcus lactis subsp. lactis... 61 6e-08
CP000580_5341(CP000580|pid:none) Mycobacterium sp. JLS, complete... 61 6e-08
EF550137_1(EF550137|pid:none) Streptomyces sp. 13 clone 13I-21 t... 61 6e-08
EU443633_23(EU443633|pid:none) Micromonospora chalcea tetrocarci... 61 8e-08
AY834753_9(AY834753|pid:none) Cystobacter fuscus cystothiazole A... 61 8e-08
AP009552_2781(AP009552|pid:none) Microcystis aeruginosa NIES-843... 61 8e-08
CU633865_16(CU633865|pid:none) Podospora anserina genomic DNA ch... 61 8e-08
AJ557546_13(AJ557546|pid:none) Melittangium lichenicola melithia... 61 8e-08
AY971512_1(AY971512|pid:none) Xylaria sp. BCC 1067 polyketide sy... 60 1e-07
GQ166664_1(GQ166664|pid:none) Actinoplanes sp. N902-109 polyketi... 60 1e-07
FJ872523_20(FJ872523|pid:none) Streptomyces sp. DSM 21069 putati... 60 1e-07
CU458896_2190(CU458896|pid:none) Mycobacterium abscessus chromos... 60 1e-07
AY899214_2(AY899214|pid:none) Streptomyces aizunensis strain NRR... 60 1e-07
AF081920_5(AF081920|pid:none) Pseudomonas fluorescens strain Pf-... 60 1e-07
CP000117_4713(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 60 1e-07
AM270324_23(AM270324|pid:none) Aspergillus niger contig An14c017... 60 1e-07
CP000425_739(CP000425|pid:none) Lactococcus lactis subsp. cremor... 60 2e-07
DQ176871_14(DQ176871|pid:none) Streptomyces aureofaciens strain ... 60 2e-07
AY495602_1(AY495602|pid:none) Gibberella moniliformis polyketide... 60 2e-07
AM944567_1(AM944567|pid:none) Aspergillus carbonarius partial pk... 60 2e-07
CU633870_146(CU633870|pid:none) Podospora anserina genomic DNA c... 60 2e-07
AM270341_48(AM270341|pid:none) Aspergillus niger contig An15c014... 60 2e-07
FJ872523_19(FJ872523|pid:none) Streptomyces sp. DSM 21069 putati... 60 2e-07
AF319998_6(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 60 2e-07
AY899214_3(AY899214|pid:none) Streptomyces aizunensis strain NRR... 59 2e-07
EU140798_1(EU140798|pid:none) Cylindrospermopsis raciborskii AWT... 59 2e-07
CP000850_2328(CP000850|pid:none) Salinispora arenicola CNS-205, ... 59 2e-07
DQ630728_2(DQ630728|pid:none) Streptomyces albus strain CCM4719 ... 59 2e-07
AB449340_16(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 59 2e-07
AM946600_8(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 59 2e-07
FM173265_19(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 59 2e-07
T30226(T30226) polyketide synthase - Streptomyces hygroscopicus ... 59 3e-07
AB070940_9(AB070940|pid:none) Streptomyces avermitilis oligomyci... 59 3e-07
AM055942_139(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 59 3e-07
CP000480_6182(CP000480|pid:none) Mycobacterium smegmatis str. MC... 59 3e-07
FJ545274_16(FJ545274|pid:none) Streptomyces antibioticus strain ... 59 3e-07
AY310323_20(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 59 4e-07
AF357202_4(AF357202|pid:none) Streptomyces nodosus amphotericin ... 59 4e-07
AB449340_15(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 59 4e-07
T30228(T30228) polyketide synthase - Streptomyces hygroscopicus ... 59 4e-07
CU640366_785(CU640366|pid:none) Podospora anserina genomic DNA c... 59 4e-07
EU151880_1(EU151880|pid:none) Anabaena sp. 18B6 polyketide synth... 59 4e-07
EU151883_1(EU151883|pid:none) Nostoc sp. IO-102-I polyketide syn... 59 4e-07
FM173265_18(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 59 4e-07
AP007154_450(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 58 5e-07
AF007101_4(AF007101|pid:none) Streptomyces hygroscopicus putativ... 58 5e-07
DQ272520_6(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 58 5e-07
AF007101_2(AF007101|pid:none) Streptomyces hygroscopicus putativ... 58 5e-07
AL939129_116(AL939129|pid:none) Streptomyces coelicolor A3(2) co... 58 5e-07
AM408590_2961(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 58 5e-07
AY652953_12(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 58 5e-07
AM238664_466(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 58 5e-07
CP000113_4412(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 58 5e-07
CP000325_1676(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 58 5e-07
EU569687_1(EU569687|pid:none) Pseudoalteromonas sp. NJ632 polyke... 58 5e-07
AE000516_3108(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 58 5e-07
AF183408_8(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 58 5e-07
AY899214_4(AY899214|pid:none) Streptomyces aizunensis strain NRR... 58 5e-07
CP001040_62(CP001040|pid:none) Nostoc punctiforme PCC 73102 plas... 58 7e-07
AM920436_393(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 58 7e-07
CP001287_2900(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 58 7e-07
DQ272520_5(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 58 7e-07
AB032549_4(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 58 7e-07
AM420293_2559(AM420293|pid:none) Saccharopolyspora erythraea NRR... 58 7e-07
CP001087_3151(CP001087|pid:none) Desulfobacterium autotrophicum ... 57 9e-07
CU633454_4(CU633454|pid:none) Podospora anserina genomic DNA chr... 57 9e-07
AF263912_15(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 57 9e-07
AJ441056_4(AJ441056|pid:none) Planktothrix agardhii microcystin ... 57 9e-07
EU301739_27(EU301739|pid:none) Actinomadura kijaniata fructokina... 57 9e-07
AB449340_18(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 57 9e-07
EU140798_2(EU140798|pid:none) Cylindrospermopsis raciborskii AWT... 57 9e-07
AM920436_484(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 57 9e-07
AY466441_31(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 57 9e-07
AY495646_1(AY495646|pid:none) Cochliobolus heterostrophus polyke... 57 9e-07
AP006618_4340(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 57 1e-06
AY522504_15(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 57 1e-06
AB193609_7(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetron... 57 1e-06
DQ272521_9(DQ272521|pid:none) Streptomyces sp. Eco86 B gene locu... 57 1e-06
EU151882_1(EU151882|pid:none) Nostoc sp. 152 polyketide synthase... 57 1e-06
AJ575648_7(AJ575648|pid:none) Streptomyces thioluteus aureothin ... 57 1e-06
AB179766_1(AB179766|pid:none) Alternaria alternata AF-toxin bios... 57 1e-06
AY495660_1(AY495660|pid:none) Cochliobolus heterostrophus polyke... 57 1e-06
AF130309_1(AF130309|pid:none) Exophiala dermatitidis type I poly... 49 1e-06
FM211192_2361(FM211192|pid:none) Mycobacterium leprae Br4923, co... 57 2e-06
AM270302_11(AM270302|pid:none) Aspergillus niger contig An13c008... 57 2e-06
AJ639921_1(AJ639921|pid:none) Uncultured bacterium partial pks4 ... 57 2e-06
S73013(S73013) polyketide synthase pksC - Mycobacterium leprae ... 57 2e-06
A87204(A87204) polyketide synthase [imported] - Mycobacterium le... 57 2e-06
CP000511_3079(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 57 2e-06
AP009552_3857(AP009552|pid:none) Microcystis aeruginosa NIES-843... 57 2e-06
AE001437_3300(AE001437|pid:none) Clostridium acetobutylicum ATCC... 57 2e-06
AB435553_2(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 57 2e-06
DQ272521_10(DQ272521|pid:none) Streptomyces sp. Eco86 B gene loc... 57 2e-06
AB072444_1(AB072444|pid:none) Aspergillus terreus at1 gene for p... 57 2e-06
CP000725_1649(CP000725|pid:none) Streptococcus gordonii str. Cha... 57 2e-06
AM238664_468(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 57 2e-06
AB032549_1(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 57 2e-06
CP001291_2672(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 57 2e-06
AL035480_1(AL035480|pid:none) Mycobacterium leprae cosmid B12. ... 57 2e-06
DQ149987_4(DQ149987|pid:none) Streptomyces neyagawaensis concana... 57 2e-06
EU047579_1(EU047579|pid:none) Dothiorella aegiceri putative poly... 57 2e-06
AY899214_9(AY899214|pid:none) Streptomyces aizunensis strain NRR... 57 2e-06
AM270206_1(AM270206|pid:none) Aspergillus niger contig An09c0170... 57 2e-06
BA000030_421(BA000030|pid:none) Streptomyces avermitilis MA-4680... 57 2e-06
DQ116941_31(DQ116941|pid:none) Streptomyces antibioticus acetylt... 56 2e-06
(Q12397) RecName: Full=Putative sterigmatocystin biosynthesis po... 56 2e-06
CP001601_2360(CP001601|pid:none) Corynebacterium aurimucosum ATC... 56 2e-06
CP000431_4186(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 56 2e-06
CP000384_2818(CP000384|pid:none) Mycobacterium sp. MCS, complete... 56 2e-06
CP001037_2819(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 56 2e-06
L39121_1(L39121|pid:none) Emericella nidulans polyketide synthas... 56 2e-06
CP001037_2818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 56 2e-06
AJ278573_4(AJ278573|pid:none) Streptomyces natalensis pimaricin ... 56 2e-06
DQ272522_1(DQ272522|pid:none) Streptomyces sp. Eco86 B gene locu... 56 2e-06
AF210843_9(AF210843|pid:none) Sorangium cellulosum strain So ce9... 56 2e-06
(Q10978) RecName: Full=Phenolpthiocerol synthesis polyketide syn... 56 2e-06
U78289_5(U78289|pid:none) Streptomyces fradiae tylactone synthas... 56 2e-06
AJ132222_1(AJ132222|pid:none) Streptomyces natalensis pimS1 gene... 56 2e-06
AM408590_2959(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 56 2e-06
AF217189_6(AF217189|pid:none) Sorangium cellulosum putative tran... 56 2e-06
AM270337_27(AM270337|pid:none) Aspergillus niger contig An15c010... 56 3e-06
AB017641_1(AB017641|pid:none) Micromonospora griseorubida gene f... 56 3e-06
DQ176595_1(DQ176595|pid:none) Monascus pilosus monacolin K biosy... 56 3e-06
AB449340_13(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 56 3e-06
EF125796_1(EF125796|pid:none) Ophiostoma piceae polyketide synth... 56 3e-06
AM920436_508(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 56 3e-06
CP000479_209(CP000479|pid:none) Mycobacterium avium 104, complet... 56 3e-06
FM173265_16(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 56 3e-06
AE016958_220(AE016958|pid:none) Mycobacterium avium subsp. parat... 56 3e-06
EF397502_12(EF397502|pid:none) Salinispora tropica strain CNB-47... 56 3e-06
AF357202_5(AF357202|pid:none) Streptomyces nodosus amphotericin ... 56 3e-06
DQ289495_1(DQ289495|pid:none) Synthetic construct EpoE (epoE) ge... 56 3e-06
AE016853_4575(AE016853|pid:none) Pseudomonas syringae pv. tomato... 55 3e-06
AM238664_478(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 55 3e-06
CP000854_2991(CP000854|pid:none) Mycobacterium marinum M, comple... 55 3e-06
CP001287_2899(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 55 3e-06
U24241_7(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 55 3e-06
AY495649_1(AY495649|pid:none) Cochliobolus heterostrophus polyke... 55 3e-06
CP000813_629(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 55 3e-06
AY649543_1(AY649543|pid:none) Cercospora nicotianae polyketide s... 55 3e-06
AM420293_5192(AM420293|pid:none) Saccharopolyspora erythraea NRR... 55 3e-06
AY495665_1(AY495665|pid:none) Cochliobolus heterostrophus polyke... 55 3e-06
DQ174320_1(DQ174320|pid:none) Streptomyces rimosus rimocidin syn... 55 3e-06
AF210843_8(AF210843|pid:none) Sorangium cellulosum strain So ce9... 55 3e-06
AP007166_610(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 55 3e-06
AM946600_12(AM946600|pid:none) Chondromyces crocatus ajudazol bi... 55 4e-06
CP000113_4410(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 55 4e-06
AE000516_3105(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 55 4e-06
CP000302_3510(CP000302|pid:none) Shewanella denitrificans OS217,... 55 4e-06
DQ116941_29(DQ116941|pid:none) Streptomyces antibioticus acetylt... 55 4e-06
AE016958_3764(AE016958|pid:none) Mycobacterium avium subsp. para... 55 4e-06
AB070949_3(AB070949|pid:none) Streptomyces avermitilis polyene m... 55 4e-06
AP011115_4155(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 55 4e-06
DQ149987_5(DQ149987|pid:none) Streptomyces neyagawaensis concana... 55 4e-06
CP000820_3810(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 55 4e-06
DQ116941_32(DQ116941|pid:none) Streptomyces antibioticus acetylt... 55 4e-06
CP000384_2819(CP000384|pid:none) Mycobacterium sp. MCS, complete... 55 4e-06
CP000511_5554(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 55 4e-06
EF451568_1(EF451568|pid:none) Micromonospora sp. 1G62 type I ket... 55 4e-06
CQ766986_1(CQ766986|pid:none) Sequence 5 from Patent WO2004005522. 55 6e-06
AM408590_2958(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 55 6e-06
CP000282_3715(CP000282|pid:none) Saccharophagus degradans 2-40, ... 55 6e-06
AL583917_101(AL583917|pid:none) Mycobacterium leprae strain TN c... 55 6e-06
AM270194_18(AM270194|pid:none) Aspergillus niger contig An09c005... 55 6e-06
AB072497_1(AB072497|pid:none) Aspergillus terreus at5 mRNA for p... 55 6e-06
AM850130_7(AM850130|pid:none) Stigmatella aurantiaca aurafuron b... 55 6e-06
AF235504_17(AF235504|pid:none) Streptomyces hygroscopicus var. a... 55 6e-06
CP000479_2340(CP000479|pid:none) Mycobacterium avium 104, comple... 55 6e-06
AY706311_1(AY706311|pid:none) Gibberella zeae type I polyketide ... 55 6e-06
AE016958_1796(AE016958|pid:none) Mycobacterium avium subsp. para... 55 6e-06
AB435553_1(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 55 6e-06
AM238664_467(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 55 6e-06
AB070940_10(AB070940|pid:none) Streptomyces avermitilis oligomyc... 55 6e-06
CP000656_1155(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 55 6e-06
AE000516_4052(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 54 8e-06
FJ405980_1(FJ405980|pid:none) Streptomyces sp. B8 strain OB8 clo... 54 8e-06
CP001037_1895(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 54 8e-06
FJ405982_1(FJ405982|pid:none) Streptomyces sp. B8 strain OB8 clo... 54 8e-06
AJ278573_3(AJ278573|pid:none) Streptomyces natalensis pimaricin ... 54 8e-06
AY899214_10(AY899214|pid:none) Streptomyces aizunensis strain NR... 54 8e-06
AM408590_3868(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 54 8e-06
FJ405985_1(FJ405985|pid:none) Streptomyces sp. D22 strain OD22 c... 54 8e-06
BX248347_118(BX248347|pid:none) Mycobacterium bovis subsp. bovis... 54 8e-06
AF217189_5(AF217189|pid:none) Sorangium cellulosum putative tran... 54 8e-06
AB193609_17(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetro... 54 8e-06
DQ289493_1(DQ289493|pid:none) Synthetic construct EpoC (epoC) ge... 54 8e-06
AJ505006_2(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 54 8e-06
CT573213_3981(CT573213|pid:none) Frankia alni str. ACN14A chromo... 54 8e-06
AM920436_399(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 54 1e-05
AM270024_5(AM270024|pid:none) Aspergillus niger contig An02c0290... 54 1e-05
DQ897667_18(DQ897667|pid:none) Polyangium cellulosum strain So c... 54 1e-05
BA000035_2701(BA000035|pid:none) Corynebacterium efficiens YS-31... 54 1e-05
FJ477836_8(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 54 1e-05
AF319998_9(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 54 1e-05
AY442225_8(AY442225|pid:none) Streptomyces diastaticus polyketid... 54 1e-05
CP000854_1167(CP000854|pid:none) Mycobacterium marinum M, comple... 54 1e-05
CU640366_51(CU640366|pid:none) Podospora anserina genomic DNA ch... 54 1e-05
AM920427_1153(AM920427|pid:none) Penicillium chrysogenum Wiscons... 54 1e-05
CP000813_630(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 54 1e-05
T28678(T28678) polyketide synthase - Streptomyces ambofaciens (f... 54 1e-05
FJ872523_5(FJ872523|pid:none) Streptomyces sp. DSM 21069 putativ... 54 1e-05
DQ190053_2(DQ190053|pid:none) Cystobacter fuscus MmxC (mmxC) and... 54 1e-05
AM889285_2396(AM889285|pid:none) Gluconacetobacter diazotrophicu... 54 1e-05
CP000113_4181(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 54 1e-05
AB070940_8(AB070940|pid:none) Streptomyces avermitilis oligomyci... 54 1e-05
AY373435_7(AY373435|pid:none) Streptomyces nanchangensis strain ... 54 1e-05
AY466441_29(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 54 1e-05
AM420293_4055(AM420293|pid:none) Saccharopolyspora erythraea NRR... 54 1e-05
EF990140_11(EF990140|pid:none) Streptomyces spiroverticillatus c... 54 1e-05
CP001581_3832(CP001581|pid:none) Clostridium botulinum A2 str. K... 54 1e-05
AJ132221_1(AJ132221|pid:none) Streptomyces natalensis pimS0 gene... 54 1e-05
AM270097_27(AM270097|pid:none) Aspergillus niger contig An04c037... 53 2e-05
CP000076_2950(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 53 2e-05
CP001503_2185(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 53 2e-05
AP009049_1419(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 53 2e-05
CP000325_1678(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 53 2e-05
AF440781_19(AF440781|pid:none) Streptomyces cinnamonensis polyet... 53 2e-05
AB070944_4(AB070944|pid:none) Streptomyces avermitilis polyketid... 53 2e-05
AM270278_16(AM270278|pid:none) Aspergillus niger contig An12c022... 53 2e-05
CP000325_1677(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 53 2e-05
CP000479_2989(CP000479|pid:none) Mycobacterium avium 104, comple... 53 2e-05
AY495606_1(AY495606|pid:none) Botryotinia fuckeliana polyketide ... 53 2e-05
AF079138_6(AF079138|pid:none) Streptomyces venezuelae methymycin... 53 2e-05
CP000656_3375(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 53 2e-05
CU638744_786(CU638744|pid:none) Podospora anserina genomic DNA c... 53 2e-05
AY652953_13(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 53 2e-05
AP008955_3992(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 53 2e-05
AB032367_6(AB032367|pid:none) Streptomyces avermitilis polyketid... 53 2e-05
EU872212_1(EU872212|pid:none) Dirinaria applanata polyketide syn... 53 2e-05
AY495593_1(AY495593|pid:none) Gibberella moniliformis polyketide... 53 2e-05
AJ871581_7(AJ871581|pid:none) Streptomyces achromogenes subsp. r... 53 2e-05
AM850130_10(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 53 2e-05
DQ351275_18(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 53 2e-05
AM850130_13(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 53 2e-05
AB363939_11(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 53 2e-05
AY466441_30(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 53 2e-05
EU301739_10(EU301739|pid:none) Actinomadura kijaniata fructokina... 53 2e-05
AY522504_17(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 53 2e-05
FJ872525_4(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 53 2e-05
AB070949_7(AB070949|pid:none) Streptomyces avermitilis polyene m... 53 2e-05
T30283(T30283) polyketide synthase - Streptomyces sp. (strain MA... 53 2e-05
CP000854_1754(CP000854|pid:none) Mycobacterium marinum M, comple... 53 2e-05
CP000158_1174(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 53 2e-05
CP000580_2832(CP000580|pid:none) Mycobacterium sp. JLS, complete... 53 2e-05
FJ545274_17(FJ545274|pid:none) Streptomyces antibioticus strain ... 53 2e-05
CP000850_3025(CP000850|pid:none) Salinispora arenicola CNS-205, ... 53 2e-05
AP009493_6371(AP009493|pid:none) Streptomyces griseus subsp. gri... 53 2e-05
AY310323_18(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 53 2e-05
AF440781_18(AF440781|pid:none) Streptomyces cinnamonensis polyet... 53 2e-05
AM778955_67(AM778955|pid:none) Microcystis aeruginosa PCC 7806 g... 52 3e-05
FB729884_1(FB729884|pid:none) Sequence 81 from Patent WO20071495... 52 3e-05
AB376425_1(AB376425|pid:none) Cystobacter fuscus gene for polyke... 52 3e-05
AM988861_8(AM988861|pid:none) Chondromyces crocatus chondrochlor... 52 3e-05
AY510452_4(AY510452|pid:none) Aspergillus flavus isolate BN008 a... 52 3e-05
AX066431_1(AX066431|pid:none) Sequence 13 from Patent WO0100805.... 52 3e-05
CP000384_2820(CP000384|pid:none) Mycobacterium sp. MCS, complete... 52 3e-05
AY271660_17(AY271660|pid:none) Actinomadura madurae strain ATCC ... 52 3e-05
AB097904_5(AB097904|pid:none) Streptomyces carzinostaticus DNA, ... 52 3e-05
AM270193_47(AM270193|pid:none) Aspergillus niger contig An09c004... 52 3e-05
AY217789_1(AY217789|pid:none) Phoma sp. C2932 type I polyketide ... 52 3e-05
AM270240_8(AM270240|pid:none) Aspergillus niger contig An11c0230... 52 3e-05
DQ019316_6(DQ019316|pid:none) Gibberella zeae aldehyde dehydroge... 52 4e-05
CP001037_1897(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 52 4e-05
AF440781_20(AF440781|pid:none) Streptomyces cinnamonensis polyet... 52 4e-05
CP000712_3868(CP000712|pid:none) Pseudomonas putida F1, complete... 52 4e-05
FM204884_1588(FM204884|pid:none) Streptococcus equi subsp. zooep... 52 4e-05
AE016853_4576(AE016853|pid:none) Pseudomonas syringae pv. tomato... 52 4e-05
EU595749_6(EU595749|pid:none) Pseudomonas aeruginosa strain PACS... 52 4e-05
DQ116941_6(DQ116941|pid:none) Streptomyces antibioticus acetyltr... 52 4e-05
CP000480_4563(CP000480|pid:none) Mycobacterium smegmatis str. MC... 52 4e-05
AF016585_4(AF016585|pid:none) Streptomyces caelestis cytochrome ... 52 4e-05
AP009493_6370(AP009493|pid:none) Streptomyces griseus subsp. gri... 52 4e-05
FM204883_455(FM204883|pid:none) Streptococcus equi subsp. equi 4... 52 4e-05
AB070949_5(AB070949|pid:none) Streptomyces avermitilis polyene m... 52 4e-05
AY505295_1(AY505295|pid:none) Mycobacterium ulcerans clone 112 m... 52 5e-05
BX248341_70(BX248341|pid:none) Mycobacterium bovis subsp. bovis ... 52 5e-05
EU220288_2(EU220288|pid:none) Streptomyces eurythermus strain AT... 52 5e-05
BX842578_219(BX842578|pid:none) Mycobacterium tuberculosis H37Rv... 52 5e-05
AY354515_6(AY354515|pid:none) Streptomyces sp. HK803 PlmR5 (plmR... 52 5e-05
BX649209_40(BX649209|pid:none) Mycobacterium ulcerans plasmid pM... 52 5e-05
CP000628_1378(CP000628|pid:none) Agrobacterium radiobacter K84 c... 52 5e-05
AY505299_1(AY505299|pid:none) Mycobacterium ulcerans clone 122 m... 52 5e-05
EU271968_43(EU271968|pid:none) Mycobacterium liflandii 128FXT pl... 52 5e-05
AM988861_7(AM988861|pid:none) Chondromyces crocatus chondrochlor... 52 5e-05
AY652953_8(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 52 5e-05
BX649209_39(BX649209|pid:none) Mycobacterium ulcerans plasmid pM... 52 5e-05
CP000667_2725(CP000667|pid:none) Salinispora tropica CNB-440, co... 52 5e-05
AM420293_4053(AM420293|pid:none) Saccharopolyspora erythraea NRR... 52 5e-05
AF079138_3(AF079138|pid:none) Streptomyces venezuelae methymycin... 52 5e-05
AM746336_27(AM746336|pid:none) Streptomyces collinus kirromycin ... 52 5e-05
FJ430564_1(FJ430564|pid:none) Bacillus cereus strain UW85 zwitte... 52 5e-05
AJ421825_15(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 52 5e-05
AJ536156_6(AJ536156|pid:none) Anabaena sp. 90 microcystin synthe... 52 5e-05
S37580(S37580)probable acyltransferase - Mycobacterium leprae 52 5e-05
BX294144_103(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 52 5e-05
AM408590_2071(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 52 5e-05
CP000820_3406(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 52 5e-05
AE000516_2167(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 52 5e-05
(Q12053) RecName: Full=Aflatoxin biosynthesis polyketide synthas... 52 5e-05
S37581(S37581)probable acyltransferase - Mycobacterium leprae 52 5e-05
AM420293_4052(AM420293|pid:none) Saccharopolyspora erythraea NRR... 51 6e-05
CP000479_1262(CP000479|pid:none) Mycobacterium avium 104, comple... 51 6e-05
AP006618_191(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 51 6e-05
AB431632_1(AB431632|pid:none) Streptomyces sp. ID05-A0083 gene f... 51 6e-05
DQ885223_3(DQ885223|pid:none) Streptomyces violaceusniger merida... 51 6e-05
AL583925_89(AL583925|pid:none) Mycobacterium leprae strain TN co... 51 6e-05
CP000806_3757(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 51 6e-05
DQ149987_8(DQ149987|pid:none) Streptomyces neyagawaensis concana... 51 6e-05
AE014133_1581(AE014133|pid:none) Streptococcus mutans UA159, com... 51 6e-05
CP000117_4082(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 51 6e-05
AY495603_1(AY495603|pid:none) Gibberella moniliformis polyketide... 51 8e-05
AY495595_1(AY495595|pid:none) Gibberella moniliformis polyketide... 51 8e-05
AF015823_1(AF015823|pid:none) Streptomyces venezuelae venA gene,... 51 8e-05
CP000580_2831(CP000580|pid:none) Mycobacterium sp. JLS, complete... 51 8e-05
AP009493_6181(AP009493|pid:none) Streptomyces griseus subsp. gri... 51 8e-05
FJ405948_1(FJ405948|pid:none) Streptomyces griseus strain O162 c... 51 8e-05
CP000382_48(CP000382|pid:none) Clostridium novyi NT, complete ge... 51 8e-05
FJ406019_1(FJ406019|pid:none) Streptomyces griseus strain 175 cl... 51 8e-05
EU443633_22(EU443633|pid:none) Micromonospora chalcea tetrocarci... 51 8e-05
DQ897667_14(DQ897667|pid:none) Polyangium cellulosum strain So c... 51 8e-05
AY373435_3(AY373435|pid:none) Streptomyces nanchangensis strain ... 51 8e-05
AB435553_3(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 51 8e-05
FJ405993_1(FJ405993|pid:none) Streptomyces griseus strain 70 clo... 51 8e-05
FJ406013_1(FJ406013|pid:none) Streptomyces griseus strain 162 cl... 51 8e-05
FJ406050_1(FJ406050|pid:none) Streptomyces ornatus strain 1321 c... 51 8e-05
CP001037_1976(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 51 8e-05
AF405554_3(AF405554|pid:none) Cryptosporidium parvum hypothetica... 51 8e-05
CP000781_1000(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 51 8e-05
AB2012(AB2012) hypothetical protein all1648 [imported] - Nostoc ... 51 8e-05
CP000117_4716(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 51 8e-05
CP000113_4188(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 51 8e-05
CU458896_177(CU458896|pid:none) Mycobacterium abscessus chromoso... 51 8e-05
AP007169_69(AP007169|pid:none) Aspergillus oryzae RIB40 genomic ... 50 1e-04
FJ406096_1(FJ406096|pid:none) Streptomyces erumpens strain 1626 ... 50 1e-04
AP007175_43(AP007175|pid:none) Aspergillus oryzae RIB40 genomic ... 50 1e-04
AY210783_11(AY210783|pid:none) Nodularia spumigena strain NSOR10... 50 1e-04
AJ223012_2(AJ223012|pid:none) Amycolatopsis mediterranei genes e... 50 1e-04
AY117439_7(AY117439|pid:none) Streptomyces carzinostaticus subsp... 50 1e-04
AB070940_12(AB070940|pid:none) Streptomyces avermitilis oligomyc... 50 1e-04
AF040570_22(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 50 1e-04
AL939127_18(AL939127|pid:none) Streptomyces coelicolor A3(2) com... 50 1e-04
FJ406082_1(FJ406082|pid:none) Streptomyces griseus subsp. griseu... 50 1e-04
S73021(S73021) polyketide synthase pksE - Mycobacterium leprae ... 50 1e-04
EU151879_1(EU151879|pid:none) Hapalosiphon hibernicus BZ-3-1 pol... 50 1e-04
AY495654_1(AY495654|pid:none) Cochliobolus heterostrophus polyke... 50 1e-04
T28658(T28658)polyketide synthase - Sorangium cellulosum (fragme... 50 1e-04
AY495615_1(AY495615|pid:none) Botryotinia fuckeliana polyketide ... 50 1e-04
U24241_8(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 50 1e-04
AB376517_1(AB376517|pid:none) Plesiocystis sp. SIS-2 gene for po... 50 1e-04
AF040570_21(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 50 1e-04
AF516145_6(AF516145|pid:none) Lyngbya majuscula barbamide biosyn... 50 1e-04
FJ406094_1(FJ406094|pid:none) Streptomyces erumpens strain 1626 ... 50 1e-04
AJ421825_16(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 50 1e-04
AX089460_1(AX089460|pid:none) Sequence 45 from Patent WO0116303.... 50 1e-04
DQ885223_4(DQ885223|pid:none) Streptomyces violaceusniger merida... 50 1e-04
AB089954_11(AB089954|pid:none) Micromonospora griseorubida gene ... 50 1e-04
AP007151_688(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 50 1e-04
BX294154_97(BX294154|pid:none) Rhodopirellula baltica SH 1 compl... 50 1e-04
CP000820_3405(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 50 1e-04
DQ249341_3(DQ249341|pid:none) Streptomyces hygroscopicus subsp. ... 50 1e-04
AY196994_1(AY196994|pid:none) Streptomyces griseoruber heda clus... 50 1e-04
CP001037_2984(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 50 1e-04
AF202898_1(AF202898|pid:none) Streptomyces coelicolor A3(2) type... 50 1e-04
AY179507_10(AY179507|pid:none) Streptomyces hygroscopicus strain... 50 1e-04
AB196490_2(AB196490|pid:none) Aspergillus oryzae DNA, aflatoxin ... 50 2e-04
AJ278141_1(AJ278141|pid:none) Gibberella fujikuroi pks4 gene for... 50 2e-04
CP000675_2260(CP000675|pid:none) Legionella pneumophila str. Cor... 50 2e-04
BA000030_420(BA000030|pid:none) Streptomyces avermitilis MA-4680... 50 2e-04
AY423269_2(AY423269|pid:none) Streptomyces diastaticus 108 cytoc... 50 2e-04
CP000854_2322(CP000854|pid:none) Mycobacterium marinum M, comple... 50 2e-04
AJ557546_12(AJ557546|pid:none) Melittangium lichenicola melithia... 50 2e-04
DQ186598_2(DQ186598|pid:none) Cochliobolus heterostrophus strain... 50 2e-04
CP000117_3964(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 50 2e-04
AP007167_158(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 50 2e-04
AY495650_1(AY495650|pid:none) Cochliobolus heterostrophus polyke... 50 2e-04
CU459003_1166(CU459003|pid:none) Magnetospirillum gryphiswaldens... 50 2e-04
AY510454_4(AY510454|pid:none) Aspergillus nomius isolate AN13137... 50 2e-04
FJ393328_1(FJ393328|pid:none) Microcystis sp. CYN10 microcystin ... 50 2e-04
AM269996_45(AM269996|pid:none) Aspergillus niger contig An02c001... 50 2e-04
AF319998_5(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 50 2e-04
AY214003_1(AY214003|pid:none) Ceratocystis resinifera polyketide... 50 2e-04
AB279593_12(AB279593|pid:none) Microcystis aeruginosa new nonrib... 50 2e-04
CP001037_1896(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 50 2e-04
AB076803_2(AB076803|pid:none) Aspergillus oryzae aflT, pksL1, no... 50 2e-04
AY495643_1(AY495643|pid:none) Cochliobolus heterostrophus polyke... 50 2e-04
AJ580915_16(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 49 2e-04
AY834753_10(AY834753|pid:none) Cystobacter fuscus cystothiazole ... 49 2e-04
EU449979_2(EU449979|pid:none) Fusarium oxysporum strain FRC O-18... 49 2e-04
CP000667_2735(CP000667|pid:none) Salinispora tropica CNB-440, co... 49 2e-04
AF040570_25(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 49 2e-04
AB376505_1(AB376505|pid:none) Sorangium cellulosum gene for poly... 49 2e-04
FJ406092_1(FJ406092|pid:none) Streptomyces erumpens strain 1626 ... 49 2e-04
AM269971_60(AM269971|pid:none) Aspergillus niger contig An01c024... 49 2e-04
FJ406001_1(FJ406001|pid:none) Streptomyces griseus strain 124 cl... 49 2e-04
AY495652_1(AY495652|pid:none) Cochliobolus heterostrophus polyke... 49 2e-04
AL583921_77(AL583921|pid:none) Mycobacterium leprae strain TN co... 49 2e-04
EU520419_1(EU520419|pid:none) Pochonia chlamydosporia strain ATC... 49 2e-04
CP000075_4310(CP000075|pid:none) Pseudomonas syringae pv. syring... 49 2e-04
AB086653_7(AB086653|pid:none) Streptomyces halstedii vicenistati... 49 2e-04
FJ406093_1(FJ406093|pid:none) Streptomyces erumpens strain 1626 ... 49 2e-04
CP000667_2737(CP000667|pid:none) Salinispora tropica CNB-440, co... 49 2e-04
EU443633_37(EU443633|pid:none) Micromonospora chalcea tetrocarci... 49 2e-04
CP001032_1954(CP001032|pid:none) Opitutus terrae PB90-1, complet... 49 2e-04
AM778952_15(AM778952|pid:none) Microcystis aeruginosa PCC 7806 g... 49 2e-04
AM746676_3198(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 49 2e-04
AF183408_7(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 49 2e-04
CP000820_3292(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 49 3e-04
FJ393327_1(FJ393327|pid:none) Microcystis sp. CYN06 microcystin ... 49 3e-04
AM420293_4220(AM420293|pid:none) Saccharopolyspora erythraea NRR... 49 3e-04
AJ871581_38(AJ871581|pid:none) Streptomyces achromogenes subsp. ... 49 3e-04
FJ405970_1(FJ405970|pid:none) Streptomyces olivoviridis strain O... 49 3e-04
FJ406026_1(FJ406026|pid:none) Streptomyces griseus strain 175 cl... 49 3e-04
AM946600_3(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 49 3e-04
AE005672_399(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 49 3e-04
FJ406000_1(FJ406000|pid:none) Streptomyces griseus strain 124 cl... 49 3e-04
FM211187_378(FM211187|pid:none) Streptococcus pneumoniae ATCC 70... 49 3e-04
DQ885223_2(DQ885223|pid:none) Streptomyces violaceusniger merida... 49 3e-04
AY652953_1(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 49 3e-04
DQ249342_5(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 49 3e-04
AF506522_7(AF506522|pid:none) Streptomyces hygroscopicus AHBA bi... 49 3e-04
AY289595_1(AY289595|pid:none) Mycobacterium ulcerans clone C typ... 49 3e-04
AE007317_380(AE007317|pid:none) Streptococcus pneumoniae R6, com... 49 3e-04
AY509120_23(AY509120|pid:none) Streptomyces bikiniensis strain N... 49 3e-04
AF082100_3(AF082100|pid:none) Streptomyces sp. MA6548 FK506 pept... 49 4e-04
AB376393_1(AB376393|pid:none) Myxococcus sp. M1017 gene for poly... 49 4e-04
CP000854_3735(CP000854|pid:none) Mycobacterium marinum M, comple... 49 4e-04
AB032367_5(AB032367|pid:none) Streptomyces avermitilis polyketid... 49 4e-04
AE000516_1750(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 49 4e-04
AB032367_2(AB032367|pid:none) Streptomyces avermitilis polyketid... 49 4e-04
AB363939_10(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 49 4e-04
CP000717_1680(CP000717|pid:none) Mycobacterium tuberculosis F11,... 49 4e-04
EF028635_5(EF028635|pid:none) Lysobacter enzymogenes strain C3 H... 49 4e-04
AM408590_1704(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 49 4e-04
U31329_1(U31329|pid:none) Aspergillus terreus putative polyketid... 49 4e-04
BX248339_216(BX248339|pid:none) Mycobacterium bovis subsp. bovis... 49 4e-04

>(Q54KU3) RecName: Full=Probable polyketide synthase 25;
Short=dipks25; EC=2.3.1.-;
Length = 2380

Score = 115 bits (289), Expect(2) = 8e-35
Identities = 62/185 (33%), Positives = 112/185 (60%), Gaps = 3/185 (1%)
Frame = +1

Query: 55 NKITKPYLVFIFSGQGSFKNKIPLELFENGNNFKSTIMEIDNIFNEKYYGYSMFDKYKNL 234
NK P VF+F GQGS N + LEL++N F++++ +DN + Y+GYS+ +K + +
Sbjct: 558 NKNNNPITVFVFCGQGSQYNTMALELYKNEKVFRNSMDMLDNKM-KNYFGYSILEKLRAI 616

Query: 235 KENDSDSFLEQHFIHCISFMFQVSIFKLYKHYGVKPDQIVGMSLGEIASAYCSGLIDLET 414
+++D S EQ + + QVS+++LYKH+G+K ++G SLGE+ +AYCSG+ID++
Sbjct: 617 QDSDKRSVHEQTMAQPSTVIIQVSLYELYKHWGIKASFMLGHSLGEVTTAYCSGMIDIDQ 676

Query: 415 ACFISHKRACLMTKLENXXXXXXXXXXXPEDYYWDFIKPNYPSIQICGCLCYD---LILV 585
C++ + R+ L + N ++Y +++ YP+I+I CY+ I++
Sbjct: 677 LCYLIYHRSTLQIR-TNGLGKMLSINISSDEYKTNYMS-RYPTIEIA---CYNSPSSIVI 731

Query: 586 AGDQK 600
AG+++
Sbjct: 732 AGNEQ 736

Score = 55.8 bits (133), Expect(2) = 8e-35
Identities = 35/112 (31%), Positives = 59/112 (52%)
Frame = +2

Query: 593 IKNEIDQLICYLSKNEIRFHCIEGLINFHTSDIDPVENDFKQLSFQSFEPEIPNISCSTA 772
I NEI + L + EI + L +FHTS + +++D L+ QS +P IP S T+
Sbjct: 737 ILNEISK---ELKEKEIFSAMLGSLSSFHTSSQNIIKDDILNLNIQSSQPVIPTFSTVTS 793

Query: 773 KLYNKKTQDFNAEFLFHIARSPVNLGKVTNQIYETNSCLNVNRPIVLVEISP 928
L+N+ T F++E+ F PV+ + + +Y+ + IV +EI+P
Sbjct: 794 NLFNEST-IFDSEYFFDNISKPVSFTQTISNLYKHIEDNQIGSNIVFIEIAP 844

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,475,994,585
Number of extensions: 26700348
Number of successful extensions: 75404
Number of sequences better than 10.0: 1223
Number of HSP's gapped: 74594
Number of HSP's successfully gapped: 1652
Length of query: 369
Length of database: 1,061,185,681
Length adjustment: 130
Effective length of query: 239
Effective length of database: 636,287,441
Effective search space: 152072698399
Effective search space used: 152072698399
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.93 gvh: 0.35 alm: 0.34 top: 0.67 tms: 0.00 mit: 0.21 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

52.0 %: cytoplasmic
32.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: mitochondrial
4.0 %: plasma membrane
4.0 %: vesicles of secretory system

>> prediction for Contig-U03221-1 is cyt

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 1
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0