| Contig-U16281-1 |
| Contig ID |
Contig-U16281-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1726 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
5300993 |
| End point |
5302562 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
149 |
| Number of EST |
229 |
| Link to clone list |
U16281 |
| List of clone(s) |
est1=VFF252F,1,519
est2=VFC215F,137,443
est3=VFH547F,138,707
est4=VFL778F,142,572
est5=VFA715F,146,686
est6=VFI866F,146,411
est7=VFC216F,147,472
est8=AFI184F,148,739
est9=VFK780F,148,781
est10=VFH608F,150,474
est11=CFC738F,151,401
est12=VFC191F,151,505
est13=VFC257F,151,435
est14=VFE134F,152,758
est15=VFG113F,152,663
est16=VFD151F,153,687
est17=VFE391F,153,799
est18=VFK145F,153,782
est19=VFK207F,153,801
est20=VFK510F,153,745
est21=AFE119F,154,753
est22=AFH260F,154,768
est23=AFK460F,154,797
est24=AFO347F,154,797
est25=CFE159F,154,742
est26=CFE805F,154,667
est27=SFF209F,154,781
est28=SFJ713F,154,756
est29=SFK643F,154,756
est30=SFK829F,154,751
est31=VFA425F,154,780
est32=VFB747F,154,754
est33=VFD477F,154,686
est34=VFD569F,154,760
est35=VFD743F,154,781
est36=VFE211F,154,800
est37=VFE665F,154,659
est38=VFE768F,154,712
est39=VFF479F,154,651
est40=VFF486F,154,757
est41=VFG150F,154,707
est42=VFG451F,154,686
est43=VFG493F,154,722
est44=VFH315F,154,758
est45=VFI444F,154,744
est46=VFK441F,154,708
est47=VFK833F,154,773
est48=VFM621F,154,781
est49=VFO296F,154,640
est50=VFO812F,154,685
est51=AFD710F,155,741
est52=VFB792F,156,758
est53=SFC858F,158,683
est54=SFD594F,158,756
est55=VFC740F,158,774
est56=CFG614F,159,764
est57=CFI163F,159,752
est58=SFE695F,159,743
est59=VFC893F,159,780
est60=VFD290F,159,801
est61=VFE579F,159,655
est62=VFF671F,159,804
est63=VFF821F,159,804
est64=VFG382F,159,601
est65=VFG608F,159,755
est66=VFH331F,159,601
est67=VFI101F,159,801
est68=VFI124F,159,759
est69=VFO142F,159,705
est70=CFA341F,160,772
est71=VFA272F,160,782
est72=AFD493F,163,742
est73=AFD495F,163,675
est74=CFJ461F,163,754
est75=SFF559F,163,757
est76=SFK596F,163,782
est77=SFK648F,163,757
est78=VFD344F,163,800
est79=VFE585F,163,600
est80=VFF686F,163,773
est81=VFG779F,163,749
est82=VFH391F,163,662
est83=VFM247F,163,783
est84=VFM570F,163,781
est85=VFN189F,163,773
est86=VFO156F,163,691
est87=AFG264F,164,754
est88=FCL-AB18F,164,798
est89=SFB792F,165,702
est90=VFC412F,165,440
est91=VFC704F,165,686
est92=CHC542F,166,737
est93=VFO894F,166,681
est94=SFG513F,168,798
est95=VFF659F,168,758
est96=VFL543F,168,760
est97=VFM856F,168,801
est98=VFM866F,169,736
est99=AFD253F,172,768
est100=CFI890F,172,752
est101=VFG374F,174,758
est102=AFC894F,176,767
est103=VFM272F,176,758
est104=VFO108F,176,681
est105=AFI373F,178,799
est106=VFE288F,178,804
est107=VFD717F,179,780
est108=VFI837F,179,797
est109=VFN772F,181,771
est110=VFD332F,182,748
est111=AFF528F,184,754
est112=SFB366F,184,800
est113=SLG531F,188,844
est114=SLI709F,188,388
est115=AFB225F,191,794
est116=VFI584F,192,802
est117=AFC443F,195,776
est118=VFB832F,199,771
est119=VFO680F,200,775
est120=VSJ738F,211,756
est121=AFL133F,224,771
est122=VFA326F,224,760
est123=VFI392F,224,339
est124=VFJ380F,224,781
est125=AFA144F,225,590
est126=AFL450F,227,680
est127=VFC308F,227,672
est128=VFA303F,229,733
est129=VFJ760F,229,754
est130=VFJ627F,233,686
est131=VFA739F,235,761
est132=CHC163F,255,397
est133=VFE746F,286,793
est134=VFA573F,304,857
est135=SFJ209F,306,533
est136=VFJ354F,323,623
est137=VFG357F,453,1080
est138=VSK485E,581,1585
est139=VFE288Z,826,1616
est140=VFD717Z,828,1615
est141=AFG264Z,837,1595
est142=VFD344Z,837,1612
est143=SFK596Z,840,1538
est144=SFG513Z,842,1597
est145=VFE211Z,848,1615
est146=VFK833Z,852,1616
est147=VFD290Z,853,1616
est148=VFF821Z,854,1616
est149=VFF659Z,856,1619
est150=VFN189Z,879,1615
est151=AFD253Z,882,1595
est152=AFF528Z,883,1564
est153=SFK643Z,884,1596
est154=SFK648Z,884,1596
est155=AFD493Z,885,1555
est156=VHK836Z,885,1063
est157=AFE169Z,886,1590
est158=AFI184Z,886,1596
est159=SFC858Z,886,1594
est160=SFB792Z,888,1596
est161=CFC738Z,890,1596
est162=VFA715Z,892,1576
est163=VFK145Z,892,1604
est164=VFO680Z,892,1613
est165=VFO812Z,892,1585
est166=VFE134Z,893,1615
est167=VFH547Z,893,1615
est168=VFK510Z,893,1615
est169=VFF486Z,895,1615
est170=VFD477Z,899,1616
est171=SFJ713Z,901,1596
est172=VFO156Z,909,1599
est173=AFH260Z,916,1598
est174=SFB366Z,916,1594
est175=AFL133Z,918,1592
est176=CFI163Z,918,1593
est177=SFK829Z,919,1601
est178=SFF559Z,921,1596
est179=AFL450Z,922,1586
est180=CFE805Z,926,1596
est181=VFA303Z,931,1576
est182=VFJ627Z,931,1606
est183=VSE518Z,932,1655
est184=AFD495Z,934,1595
est185=VFG608Z,936,1616
est186=VFF252Z,937,1613
est187=VFD332Z,939,1616
est188=VFI124Z,943,1614
est189=VFI174Z,949,1615
est190=AFD710Z,952,1593
est191=VFA573Z,963,1613
est192=VFE768Z,963,1615
est193=VFB747Z,964,1585
est194=VSJ650E,971,1615
est195=VFG113Z,973,1613
est196=VSB118Z,1011,1624
est197=FCL-AB18Z,1031,1673
est198=VFB832Z,1042,1575
est199=VFH391Z,1047,1584
est200=VFG374Z,1049,1585
est201=SLI468Z,1070,1606
est202=VFE579Z,1088,1615
est203=VFA739Z,1089,1549
est204=VSB101Z,1098,1624
est205=VFI584Z,1116,1624
est206=VFH315Z,1137,1571
est207=VSB360Z,1164,1726
est208=SLI709Z,1174,1607
est209=VFE665Z,1190,1584
est210=VFJ380Z,1202,1523
est211=VFI101Z,1203,1638
est212=CFH551Z,1205,1406
est213=VFC215Z,1213,1571
est214=VFK780Z,1217,1662
est215=VFI866Z,1226,1667
est216=VFJ354Z,1246,1523
est217=CFJ461Z,1262,1643
est218=VFL778Z,1264,1565
est219=VFO296Z,1272,1378
est220=VSJ738Z,1272,1624
est221=VFC412Z,1283,1572
est222=VFH608Z,1287,1662
est223=VFM866Z,1333,1566
est224=VFC740Z,1334,1625
est225=VFD743Z,1337,1647
est226=VFM621Z,1359,1573
est227=VFM570Z,1374,1551
est228=AFA144Z,1414,1649
est229=VFM856Z,1437,1661
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.24 |
| Homology vs DNA |
Query= Contig-U16281-1 (Contig-U16281-1Q) /CSM_Contig/Contig-U16281-1Q.Seq.d
(1726 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ343985) Dictyostelium discoideum cDNA clone:dda17g21, 3' ... 1354 0.0 1
(BJ429047) Dictyostelium discoideum cDNA clone:ddv2n03, 3' e... 1312 0.0 1
(BJ401167) Dictyostelium discoideum cDNA clone:dds22j08, 3' ... 1289 0.0 1
(AU061897) Dictyostelium discoideum slug cDNA, clone SLG531. 1189 0.0 2
(BJ434286) Dictyostelium discoideum cDNA clone:ddv16m11, 3' ... 1181 0.0 4
(BJ326718) Dictyostelium discoideum cDNA clone:dda17b19, 5' ... 1179 0.0 1
(BJ412812) Dictyostelium discoideum cDNA clone:ddv9o22, 5' e... 1178 0.0 1
(BJ410471) Dictyostelium discoideum cDNA clone:ddv12m18, 5' ... 1178 0.0 1
(BJ327740) Dictyostelium discoideum cDNA clone:dda21h16, 5' ... 1176 0.0 1
(BJ414337) Dictyostelium discoideum cDNA clone:ddv18g21, 5' ... 1174 0.0 1
(BJ387582) Dictyostelium discoideum cDNA clone:dds3d17, 5' e... 1174 0.0 1
(BJ416529) Dictyostelium discoideum cDNA clone:ddv26p14, 5' ... 1172 0.0 1
(BJ415015) Dictyostelium discoideum cDNA clone:ddv21m02, 5' ... 1172 0.0 1
(BJ413790) Dictyostelium discoideum cDNA clone:ddv17a01, 5' ... 1172 0.0 1
(BJ412300) Dictyostelium discoideum cDNA clone:ddv7c24, 5' e... 1172 0.0 1
(BJ412564) Dictyostelium discoideum cDNA clone:ddv9e04, 5' e... 1170 0.0 1
(BJ412203) Dictyostelium discoideum cDNA clone:ddv7h11, 5' e... 1170 0.0 1
(BJ410334) Dictyostelium discoideum cDNA clone:ddv12j06, 5' ... 1170 0.0 1
(BJ412775) Dictyostelium discoideum cDNA clone:ddv9f23, 5' e... 1168 0.0 1
(BJ328769) Dictyostelium discoideum cDNA clone:dda29n11, 5' ... 1168 0.0 1
(BJ414197) Dictyostelium discoideum cDNA clone:ddv18j10, 5' ... 1164 0.0 1
(BJ390889) Dictyostelium discoideum cDNA clone:dds14i03, 5' ... 1162 0.0 1
(BJ325973) Dictyostelium discoideum cDNA clone:dda3a08, 5' e... 1162 0.0 1
(BJ430496) Dictyostelium discoideum cDNA clone:ddv7p07, 3' e... 1160 0.0 2
(AU263163) Dictyostelium discoideum vegetative cDNA clone:VS... 1152 0.0 3
(BJ433554) Dictyostelium discoideum cDNA clone:ddv22b10, 3' ... 1150 0.0 3
(BJ432134) Dictyostelium discoideum cDNA clone:ddv17c19, 3' ... 1150 0.0 2
(BJ430854) Dictyostelium discoideum cDNA clone:ddv9e04, 3' e... 1150 0.0 3
(BJ430575) Dictyostelium discoideum cDNA clone:ddv7c24, 3' e... 1150 0.0 2
(BJ428053) Dictyostelium discoideum cDNA clone:ddv10h17, 3' ... 1150 0.0 2
(BJ402004) Dictyostelium discoideum cDNA clone:dds20j03, 3' ... 1150 0.0 2
(BJ401198) Dictyostelium discoideum cDNA clone:dds22o12, 3' ... 1150 0.0 2
(BJ399219) Dictyostelium discoideum cDNA clone:dds4h23, 3' e... 1150 0.0 2
(BJ345289) Dictyostelium discoideum cDNA clone:dda23a09, 3' ... 1150 0.0 2
(BJ341728) Dictyostelium discoideum cDNA clone:dda7n24, 3' e... 1150 0.0 2
(BJ341653) Dictyostelium discoideum cDNA clone:dda7i14, 3' e... 1150 0.0 2
(BJ428486) Dictyostelium discoideum cDNA clone:ddv12j06, 3' ... 1146 0.0 2
(BJ431444) Dictyostelium discoideum cDNA clone:ddv14o02, 3' ... 1142 0.0 2
(BJ374074) Dictyostelium discoideum cDNA clone:ddc6l09, 3' e... 1142 0.0 2
(BJ342960) Dictyostelium discoideum cDNA clone:dda15g16, 3' ... 1142 0.0 2
(BJ390581) Dictyostelium discoideum cDNA clone:dds22o23, 5' ... 1138 0.0 1
(AU261826) Dictyostelium discoideum vegetative cDNA clone:VS... 1136 0.0 1
(BJ416243) Dictyostelium discoideum cDNA clone:ddv25m12, 5' ... 1136 0.0 1
(BJ329522) Dictyostelium discoideum cDNA clone:dda25e11, 5' ... 1136 0.0 1
(BJ431171) Dictyostelium discoideum cDNA clone:ddv13i03, 3' ... 1134 0.0 2
(BJ415078) Dictyostelium discoideum cDNA clone:ddv21i11, 5' ... 1134 0.0 1
(BJ410747) Dictyostelium discoideum cDNA clone:ddv1o18, 5' e... 1134 0.0 1
(BJ324214) Dictyostelium discoideum cDNA clone:dda5f12, 5' e... 1134 0.0 1
(BJ416658) Dictyostelium discoideum cDNA clone:ddv26i06, 5' ... 1132 0.0 1
(BJ415558) Dictyostelium discoideum cDNA clone:ddv22p19, 5' ... 1132 0.0 1
(BJ412405) Dictyostelium discoideum cDNA clone:ddv8f11, 5' e... 1132 0.0 1
(AU270258) Dictyostelium discoideum vegetative cDNA clone:VS... 1130 0.0 2
(BJ412076) Dictyostelium discoideum cDNA clone:ddv6j24, 5' e... 1130 0.0 1
(BJ410622) Dictyostelium discoideum cDNA clone:ddv1b08, 5' e... 1130 0.0 1
(BJ358370) Dictyostelium discoideum cDNA clone:ddc1b11, 5' e... 1126 0.0 1
(BJ416507) Dictyostelium discoideum cDNA clone:ddv26k17, 5' ... 1124 0.0 1
(BJ412345) Dictyostelium discoideum cDNA clone:ddv8b05, 5' e... 1122 0.0 1
(BJ417542) Dictyostelium discoideum cDNA clone:ddv30o20, 5' ... 1120 0.0 1
(BJ411959) Dictyostelium discoideum cDNA clone:ddv6p09, 5' e... 1118 0.0 1
(BJ324710) Dictyostelium discoideum cDNA clone:dda7i14, 5' e... 1118 0.0 1
(BJ416910) Dictyostelium discoideum cDNA clone:ddv27a23, 5' ... 1116 0.0 1
(BJ415339) Dictyostelium discoideum cDNA clone:ddv22b10, 5' ... 1116 0.0 1
(BJ329869) Dictyostelium discoideum cDNA clone:dda26g15, 5' ... 1116 0.0 1
(BJ324561) Dictyostelium discoideum cDNA clone:dda6l24, 5' e... 1116 0.0 1
(AU270257) Dictyostelium discoideum vegetative cDNA clone:VS... 1114 0.0 2
(BJ417770) Dictyostelium discoideum cDNA clone:ddv28p17, 5' ... 1112 0.0 1
(BJ411445) Dictyostelium discoideum cDNA clone:ddv4p08, 5' e... 1112 0.0 1
(BJ359375) Dictyostelium discoideum cDNA clone:ddc14k04, 5' ... 1110 0.0 1
(BJ326177) Dictyostelium discoideum cDNA clone:dda15g16, 5' ... 1110 0.0 1
(BJ410531) Dictyostelium discoideum cDNA clone:ddv12k22, 5' ... 1108 0.0 1
(BJ435631) Dictyostelium discoideum cDNA clone:ddv27a23, 3' ... 1104 0.0 4
(BJ433476) Dictyostelium discoideum cDNA clone:ddv22c03, 3' ... 1104 0.0 3
(BJ431973) Dictyostelium discoideum cDNA clone:ddv17o05, 3' ... 1104 0.0 3
(BJ430916) Dictyostelium discoideum cDNA clone:ddv9c09, 3' e... 1104 0.0 3
(BJ430625) Dictyostelium discoideum cDNA clone:ddv8b05, 3' e... 1104 0.0 3
(BJ430594) Dictyostelium discoideum cDNA clone:ddv7j20, 3' e... 1104 0.0 3
(BJ429213) Dictyostelium discoideum cDNA clone:ddv2a19, 3' e... 1104 0.0 3
(BJ401149) Dictyostelium discoideum cDNA clone:dds22e12, 3' ... 1104 0.0 3
(BJ400635) Dictyostelium discoideum cDNA clone:dds14i03, 3' ... 1104 0.0 3
(BJ371880) Dictyostelium discoideum cDNA clone:ddc10j02, 3' ... 1104 0.0 3
(BJ347259) Dictyostelium discoideum cDNA clone:dda26g15, 3' ... 1104 0.0 3
(BJ345383) Dictyostelium discoideum cDNA clone:dda23d14, 3' ... 1104 0.0 3
(BJ342375) Dictyostelium discoideum cDNA clone:dda13o16, 3' ... 1104 0.0 3
(BJ342124) Dictyostelium discoideum cDNA clone:dda9i17, 3' e... 1104 0.0 3
(BJ436051) Dictyostelium discoideum cDNA clone:ddv29o13, 3' ... 1098 0.0 3
(BJ414644) Dictyostelium discoideum cDNA clone:ddv19p19, 5' ... 1098 0.0 1
(BJ436365) Dictyostelium discoideum cDNA clone:ddv30o20, 3' ... 1096 0.0 3
(BJ433294) Dictyostelium discoideum cDNA clone:ddv21i11, 3' ... 1096 0.0 3
(BJ432937) Dictyostelium discoideum cDNA clone:ddv20e08, 3' ... 1096 0.0 3
(BJ430463) Dictyostelium discoideum cDNA clone:ddv7h11, 3' e... 1096 0.0 3
(BJ428597) Dictyostelium discoideum cDNA clone:ddv12e16, 3' ... 1096 0.0 3
(BJ428338) Dictyostelium discoideum cDNA clone:ddv11g14, 3' ... 1096 0.0 3
(BJ399566) Dictyostelium discoideum cDNA clone:dds6d16, 3' e... 1096 0.0 3
(BJ398466) Dictyostelium discoideum cDNA clone:dds12e15, 3' ... 1096 0.0 3
(BJ375161) Dictyostelium discoideum cDNA clone:ddc17m15, 3' ... 1096 0.0 3
(C23821) Dictyostelium discoideum gamete cDNA, clone FCL-AB18. 1090 0.0 2
(BJ415953) Dictyostelium discoideum cDNA clone:ddv24e11, 5' ... 1090 0.0 1
(BJ412470) Dictyostelium discoideum cDNA clone:ddv8i17, 5' e... 1090 0.0 1
(BJ401346) Dictyostelium discoideum cDNA clone:dds22o23, 3' ... 1090 0.0 2
(BJ325296) Dictyostelium discoideum cDNA clone:dda13o16, 5' ... 1090 0.0 1
(BJ323804) Dictyostelium discoideum cDNA clone:dda12g07, 5' ... 1090 0.0 1
(BJ436136) Dictyostelium discoideum cDNA clone:ddv30h04, 3' ... 1088 0.0 3
(BJ413861) Dictyostelium discoideum cDNA clone:ddv17o05, 5' ... 1088 0.0 1
(BJ390447) Dictyostelium discoideum cDNA clone:dds22o12, 5' ... 1088 0.0 1
(BJ387146) Dictyostelium discoideum cDNA clone:dds12e15, 5' ... 1088 0.0 1
(BJ324988) Dictyostelium discoideum cDNA clone:dda9e05, 5' e... 1088 0.0 1
(BJ416302) Dictyostelium discoideum cDNA clone:ddv25o18, 5' ... 1086 0.0 1
(BJ413349) Dictyostelium discoideum cDNA clone:ddv15n03, 5' ... 1086 0.0 1
(BJ411546) Dictyostelium discoideum cDNA clone:ddv4h23, 5' e... 1086 0.0 1
(BJ410439) Dictyostelium discoideum cDNA clone:ddv12e16, 5' ... 1086 0.0 1
(BJ390405) Dictyostelium discoideum cDNA clone:dds22e12, 5' ... 1086 0.0 1
(BJ388300) Dictyostelium discoideum cDNA clone:dds8k23, 5' e... 1086 0.0 1
(BJ361795) Dictyostelium discoideum cDNA clone:ddc18d24, 5' ... 1086 0.0 1
(BJ328179) Dictyostelium discoideum cDNA clone:dda23a09, 5' ... 1086 0.0 1
(BJ429658) Dictyostelium discoideum cDNA clone:ddv4n11, 3' e... 1084 0.0 2
(BJ410278) Dictyostelium discoideum cDNA clone:ddv11l22, 5' ... 1084 0.0 1
(BJ361986) Dictyostelium discoideum cDNA clone:ddc19j16, 5' ... 1082 0.0 1
(BJ412999) Dictyostelium discoideum cDNA clone:ddv13d19, 5' ... 1078 0.0 1
(BJ411440) Dictyostelium discoideum cDNA clone:ddv4n11, 5' e... 1078 0.0 1
(BJ411025) Dictyostelium discoideum cDNA clone:ddv2a19, 5' e... 1078 0.0 1
(BJ389800) Dictyostelium discoideum cDNA clone:dds20j03, 5' ... 1078 0.0 1
(BJ361550) Dictyostelium discoideum cDNA clone:ddc17m15, 5' ... 1078 0.0 1
(BJ329965) Dictyostelium discoideum cDNA clone:dda26k24, 5' ... 1078 0.0 1
(BJ341716) Dictyostelium discoideum cDNA clone:dda7j24, 3' e... 1074 0.0 2
(BJ428737) Dictyostelium discoideum cDNA clone:ddv1f01, 3' e... 1072 0.0 2
(BJ340256) Dictyostelium discoideum cDNA clone:dda12g07, 3' ... 1013 0.0 3
(C23820) Dictyostelium discoideum gamete cDNA, clone FCL-AB18. 1001 0.0 3
(BJ341749) Dictyostelium discoideum cDNA clone:dda8d03, 3' e... 991 0.0 4
(BJ398995) Dictyostelium discoideum cDNA clone:dds3d17, 3' e... 904 0.0 4
(BJ428429) Dictyostelium discoideum cDNA clone:ddv11l22, 3' ... 872 0.0 3
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 848 0.0 3
(BJ431125) Dictyostelium discoideum cDNA clone:ddv9o22, 3' e... 739 0.0 4
(BJ412936) Dictyostelium discoideum cDNA clone:ddv13b15, 5' ... 702 0.0 2
(BJ386853) Dictyostelium discoideum cDNA clone:dds11a04, 5' ... 948 0.0 3
(BJ413107) Dictyostelium discoideum cDNA clone:ddv14o02, 5' ... 1072 0.0 1
(BJ412623) Dictyostelium discoideum cDNA clone:ddv9c09, 5' e... 1070 0.0 1
(BJ413279) Dictyostelium discoideum cDNA clone:ddv14n19, 5' ... 1068 0.0 1
(BJ386841) Dictyostelium discoideum cDNA clone:dds10m24, 5' ... 1065 0.0 1
(BJ415262) Dictyostelium discoideum cDNA clone:ddv22c03, 5' ... 1061 0.0 1
(BJ326735) Dictyostelium discoideum cDNA clone:dda17g21, 5' ... 1061 0.0 1
(BJ412228) Dictyostelium discoideum cDNA clone:ddv7p07, 5' e... 1059 0.0 1
(BJ361042) Dictyostelium discoideum cDNA clone:ddc9e15, 5' e... 1059 0.0 1
(BJ324761) Dictyostelium discoideum cDNA clone:dda7j24, 5' e... 1059 0.0 1
(BJ410631) Dictyostelium discoideum cDNA clone:ddv1d07, 5' e... 1057 0.0 1
(BJ363556) Dictyostelium discoideum cDNA clone:ddc27c11, 5' ... 1057 0.0 1
(BJ324786) Dictyostelium discoideum cDNA clone:dda8d03, 5' e... 1057 0.0 1
(BJ413904) Dictyostelium discoideum cDNA clone:ddv17h12, 5' ... 1051 0.0 1
(BJ390422) Dictyostelium discoideum cDNA clone:dds22j08, 5' ... 1051 0.0 1
(AU270394) Dictyostelium discoideum vegetative cDNA clone:VS... 1049 0.0 1
(BJ416471) Dictyostelium discoideum cDNA clone:ddv26d18, 5' ... 1043 0.0 1
(BJ414845) Dictyostelium discoideum cDNA clone:ddv20h15, 5' ... 1035 0.0 1
(BJ431855) Dictyostelium discoideum cDNA clone:ddv15f23, 3' ... 1031 0.0 1
(BJ410942) Dictyostelium discoideum cDNA clone:ddv2n09, 5' e... 1021 0.0 1
(AU271277) Dictyostelium discoideum vegetative cDNA clone:VS... 1015 0.0 1
(BJ413022) Dictyostelium discoideum cDNA clone:ddv13j24, 5' ... 1015 0.0 1
(BJ431329) Dictyostelium discoideum cDNA clone:ddv13d19, 3' ... 999 0.0 2
(AU053365) Dictyostelium discoideum slug cDNA, clone SLI468. 1003 0.0 1
(BJ409886) Dictyostelium discoideum cDNA clone:ddv10l11, 5' ... 1003 0.0 1
(BJ409932) Dictyostelium discoideum cDNA clone:ddv10h17, 5' ... 995 0.0 1
(BJ410571) Dictyostelium discoideum cDNA clone:ddv1f01, 5' e... 993 0.0 1
(BJ415043) Dictyostelium discoideum cDNA clone:ddv21b12, 5' ... 987 0.0 1
(BJ412939) Dictyostelium discoideum cDNA clone:ddv13c13, 5' ... 985 0.0 1
(BJ428147) Dictyostelium discoideum cDNA clone:ddv10m19, 3' ... 981 0.0 1
(BJ417055) Dictyostelium discoideum cDNA clone:ddv29c11, 5' ... 981 0.0 1
(AU261819) Dictyostelium discoideum vegetative cDNA clone:VS... 979 0.0 1
(BJ387773) Dictyostelium discoideum cDNA clone:dds4h23, 5' e... 977 0.0 1
(AU271276) Dictyostelium discoideum vegetative cDNA clone:VS... 456 0.0 3
(BJ413626) Dictyostelium discoideum cDNA clone:ddv16m11, 5' ... 942 0.0 2
(BJ417166) Dictyostelium discoideum cDNA clone:ddv29o13, 5' ... 954 0.0 1
(BJ410877) Dictyostelium discoideum cDNA clone:ddv2n03, 5' e... 944 0.0 1
(BJ330183) Dictyostelium discoideum cDNA clone:dda27l15, 5' ... 944 0.0 1
(BJ417282) Dictyostelium discoideum cDNA clone:ddv30h04, 5' ... 942 0.0 1
(BJ412252) Dictyostelium discoideum cDNA clone:ddv7e13, 5' e... 938 0.0 1
(BJ388636) Dictyostelium discoideum cDNA clone:dds6d16, 5' e... 938 0.0 1
(BJ412952) Dictyostelium discoideum cDNA clone:ddv13f14, 5' ... 936 0.0 1
(BJ411854) Dictyostelium discoideum cDNA clone:ddv6h01, 5' e... 936 0.0 1
(BJ417530) Dictyostelium discoideum cDNA clone:ddv30l24, 5' ... 934 0.0 1
(BJ417034) Dictyostelium discoideum cDNA clone:ddv29o01, 5' ... 934 0.0 1
(BJ324773) Dictyostelium discoideum cDNA clone:dda7n24, 5' e... 934 0.0 1
(BJ358553) Dictyostelium discoideum cDNA clone:ddc10j02, 5' ... 918 0.0 1
(BJ412318) Dictyostelium discoideum cDNA clone:ddv7j20, 5' e... 496 0.0 2
(BJ328258) Dictyostelium discoideum cDNA clone:dda23d14, 5' ... 900 0.0 1
(BJ412852) Dictyostelium discoideum cDNA clone:ddv13i03, 5' ... 898 0.0 1
(BJ429663) Dictyostelium discoideum cDNA clone:ddv4p08, 3' e... 825 0.0 3
(BJ429123) Dictyostelium discoideum cDNA clone:ddv2n09, 3' e... 892 0.0 1
(BJ409902) Dictyostelium discoideum cDNA clone:ddv10a18, 5' ... 890 0.0 1
(AU261974) Dictyostelium discoideum vegetative cDNA clone:VS... 833 0.0 2
(BJ414748) Dictyostelium discoideum cDNA clone:ddv20e08, 5' ... 884 0.0 1
(BJ410018) Dictyostelium discoideum cDNA clone:ddv10m19, 5' ... 882 0.0 1
(BJ410192) Dictyostelium discoideum cDNA clone:ddv11g14, 5' ... 613 0.0 2
(BJ410285) Dictyostelium discoideum cDNA clone:ddv11n20, 5' ... 860 0.0 1
(BJ417240) Dictyostelium discoideum cDNA clone:ddv29o24, 5' ... 852 0.0 1
(BJ411639) Dictyostelium discoideum cDNA clone:ddv5p01, 5' e... 769 0.0 3
(AU053464) Dictyostelium discoideum slug cDNA, clone SLI709. 801 0.0 1
(BJ431703) Dictyostelium discoideum cDNA clone:ddv15n03, 3' ... 599 0.0 4
(BJ413403) Dictyostelium discoideum cDNA clone:ddv15n07, 5' ... 775 0.0 1
(BJ413001) Dictyostelium discoideum cDNA clone:ddv13d21, 5' ... 775 0.0 1
(BJ410002) Dictyostelium discoideum cDNA clone:ddv10i21, 5' ... 773 0.0 1
(BJ428021) Dictyostelium discoideum cDNA clone:ddv10a18, 3' ... 726 0.0 1
(BJ325544) Dictyostelium discoideum cDNA clone:dda1g11, 5' e... 726 0.0 1
(BJ429870) Dictyostelium discoideum cDNA clone:ddv5m04, 3' e... 391 0.0 3
(BJ416081) Dictyostelium discoideum cDNA clone:ddv24l19, 5' ... 581 e-161 1
(BJ414568) Dictyostelium discoideum cDNA clone:ddv19l13, 5' ... 581 e-161 1
(BJ411785) Dictyostelium discoideum cDNA clone:ddv5e23, 5' e... 551 e-156 2
(BJ429847) Dictyostelium discoideum cDNA clone:ddv5h04, 3' e... 509 e-150 2
(BJ411637) Dictyostelium discoideum cDNA clone:ddv5o04, 5' e... 511 e-140 1
(BJ413556) Dictyostelium discoideum cDNA clone:ddv16o02, 5' ... 509 e-139 1
(BJ433796) Dictyostelium discoideum cDNA clone:ddv22p19, 3' ... 458 e-129 2
(BJ411611) Dictyostelium discoideum cDNA clone:ddv5h04, 5' e... 458 e-124 1
(BJ432484) Dictyostelium discoideum cDNA clone:ddv18g21, 3' ... 440 e-119 1
(BJ411708) Dictyostelium discoideum cDNA clone:ddv5a16, 5' e... 289 e-117 2
(BJ432384) Dictyostelium discoideum cDNA clone:ddv18d18, 3' ... 402 e-116 2
(BJ411627) Dictyostelium discoideum cDNA clone:ddv5m04, 5' e... 309 e-112 2
(BJ414250) Dictyostelium discoideum cDNA clone:ddv18d18, 5' ... 389 e-103 1
(BJ389498) Dictyostelium discoideum cDNA clone:dds19a04, 5' ... 278 e-102 2
(BJ435111) Dictyostelium discoideum cDNA clone:ddv26i06, 3' ... 381 e-101 1
(BJ360495) Dictyostelium discoideum cDNA clone:ddc6l09, 5' e... 367 9e-97 1
(AU062251) Dictyostelium discoideum slug cDNA, clone SLI709. 365 4e-96 1
(BJ434206) Dictyostelium discoideum cDNA clone:ddv16o02, 3' ... 325 6e-90 2
(BJ443244) Dictyostelium discoideum cDNA clone:ddv52h10, 3' ... 206 6e-87 2
(BJ347368) Dictyostelium discoideum cDNA clone:dda26k24, 3' ... 270 3e-76 2
(BJ413318) Dictyostelium discoideum cDNA clone:ddv15g01, 5' ... 295 3e-75 1
(BJ374855) Dictyostelium discoideum cDNA clone:ddc16e13, 3' ... 276 3e-69 1
(BJ325020) Dictyostelium discoideum cDNA clone:dda9c11, 5' e... 270 2e-67 1
(BJ363440) Dictyostelium discoideum cDNA clone:ddc26m15, 5' ... 264 1e-65 1
(BJ431900) Dictyostelium discoideum cDNA clone:ddv17a01, 3' ... 260 2e-64 1
(BJ434761) Dictyostelium discoideum cDNA clone:ddv24l19, 3' ... 256 2e-63 1
(BJ432822) Dictyostelium discoideum cDNA clone:ddv19p19, 3' ... 242 4e-59 1
(BJ375689) Dictyostelium discoideum cDNA clone:ddc19j16, 3' ... 238 6e-58 1
(AL409253) T7 end of clone AV0AA013G12 of library AV0AA from... 70 3e-54 9
(BJ417858) Dictyostelium discoideum cDNA clone:ddv15f23, 5' ... 222 3e-53 1
(AY145050) Kluyveromyces lactis clone P2263 CIT1 gene, parti... 101 1e-50 8
(BJ414039) Dictyostelium discoideum cDNA clone:ddv17h23, 5' ... 210 1e-49 1
(BD309247) Drug targets in Candida albicans. 76 4e-48 9
(BJ435245) Dictyostelium discoideum cDNA clone:ddv26d18, 3' ... 198 5e-46 1
(BJ432744) Dictyostelium discoideum cDNA clone:ddv19l13, 3' ... 196 2e-45 1
(EH012610) USDA-FP_185493 Lysiphlebus testaceipes adult whol... 113 2e-43 5
(DL131133) Bax-responsive genes for drug target identificati... 76 7e-40 7
(AX536976) Sequence 577 from Patent WO02064766. 76 7e-40 7
(AR941693) Sequence 577 from patent US 7101990. 76 7e-40 7
(AR548070) Sequence 3201 from patent US 6747137. 76 7e-40 7
(BJ435281) Dictyostelium discoideum cDNA clone:ddv26k17, 3' ... 172 3e-38 1
(CT836761) Oryza sativa (indica cultivar-group) cDNA clone:O... 62 1e-37 7
(EH014934) USDA-FP_187585 Lysiphlebus testaceipes adult whol... 64 2e-36 7
(FE260661) CAZO1121.rev CAZO Naegleria gruberi Flagellate St... 72 2e-35 5
(FE231317) CAPG1157.rev CAPG Naegleria gruberi amoeba stage ... 72 3e-35 5
(FE240379) CAPG5824.rev CAPG Naegleria gruberi amoeba stage ... 72 4e-35 5
(EC761690) PSE00008341 rw_mgpallid Polysphondylium pallidum ... 58 7e-35 5
(BJ394909) Dictyostelium discoideum cDNA clone:dds36o19, 5' ... 159 4e-34 1
(EH013275) USDA-FP_186091 Lysiphlebus testaceipes adult whol... 64 4e-33 6
(EC760453) PSE00001027 rw_mgpallid Polysphondylium pallidum ... 58 1e-32 5
(AU270395) Dictyostelium discoideum vegetative cDNA clone:VS... 151 1e-31 1
(AM806548) Nicotiana tabacum EST, clone nt005035014. 86 5e-31 4
(FF314876) 279396355 Pea aphid whole body normalized full le... 72 7e-31 5
(FE264801) CAZO4084.rev CAZO Naegleria gruberi Flagellate St... 72 8e-31 5
(FF315370) 279418892 Pea aphid whole body normalized full le... 72 8e-31 5
(FE246848) CAPG9637.rev CAPG Naegleria gruberi amoeba stage ... 72 9e-31 5
(FE259599) CAPH7794.rev CAPH Naegleria gruberi amoeba stage ... 72 1e-30 5
(BJ342723) Dictyostelium discoideum cDNA clone:dda1g11, 3' e... 119 1e-29 2
(DQ332672) Synthetic construct Saccharomyces cerevisiae clon... 62 2e-29 6
(EA376859) Sequence 25682 from patent US 7314974. 62 2e-29 6
(DJ207767) Method for identification of useful proteins deri... 62 2e-29 6
(AX832400) Sequence 3120 from Patent WO03072602. 62 2e-29 6
(AX821370) Sequence 3120 from Patent EP1338608. 62 2e-29 6
(BJ430211) Dictyostelium discoideum cDNA clone:ddv6p09, 3' e... 143 3e-29 1
(Z23259) S.cerevisiae mitochondrial citrate synthase gene, c... 62 3e-29 6
(BJ435300) Dictyostelium discoideum cDNA clone:ddv26p14, 3' ... 82 7e-29 2
(X00782) Yeast gene for citrate synthase. 62 3e-28 6
(CU437204) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 72 7e-28 7
(FE260662) CAZO1121.fwd CAZO Naegleria gruberi Flagellate St... 72 4e-27 4
(Z71616) S.cerevisiae chromosome XIV reading frame ORF YNR001c. 62 5e-27 6
(EC387370) G05_G05g1l9_pDNRf_451948 Myzus persicae, tobacco ... 76 2e-26 4
(EE261685) E04_E04ff3k7_pDNRf_514308 Myzus persicae, line F0... 76 1e-24 4
(AF193854) Saccharomyces kluyveri putative citrate synthase ... 66 2e-24 7
(AY144810) Saccharomyces bayanus clone Contig3962 CIT1 gene,... 64 3e-24 6
(EH632791) EST3898 LK04 Laupala kohalensis cDNA clone 106102... 68 5e-24 4
(AM989984) Zygosaccharomyces rouxii strain CBS 732 Contig5. 58 7e-24 10
(X77395) S.cerevisiae N2019, N2021, N2023, N2025, N2027, N20... 62 1e-23 6
(AY126274) Candida krusei citrate synthase (CS1) gene, compl... 54 3e-23 6
(BJ430686) Dictyostelium discoideum cDNA clone:ddv8f11, 3' e... 92 4e-23 2
(EH009748) USDA-FP_182915 Lysiphlebus testaceipes adult whol... 64 7e-22 4
(EU444262) Saccharomyces paradoxus strain T76.6 CIT2 gene, p... 64 8e-22 5
(EU444261) Saccharomyces paradoxus strain T68.2 CIT2 gene, p... 64 8e-22 5
(EU444259) Saccharomyces paradoxus strain T32.1 CIT2 gene, p... 64 8e-22 5
(EU444258) Saccharomyces paradoxus strain T26.3 CIT2 gene, p... 64 8e-22 5
(EU444257) Saccharomyces paradoxus strain T18.2 CIT2 gene, p... 64 8e-22 5
(EU444256) Saccharomyces paradoxus strain Q43.5 CIT2 gene, p... 64 8e-22 5
(EU444255) Saccharomyces paradoxus strain Q15.1 CIT2 gene, p... 64 8e-22 5
(EU444254) Saccharomyces paradoxus strain Q14.4 CIT2 gene, p... 64 8e-22 5
(EU444253) Saccharomyces paradoxus strain Q6.1 CIT2 gene, pa... 64 8e-22 5
(EU444252) Saccharomyces paradoxus strain Q4.1 CIT2 gene, pa... 64 8e-22 5
(EU444260) Saccharomyces paradoxus strain T62.1 CIT2 gene, p... 64 8e-22 5
(CN764018) ID0AAA8DA01RM1 ApMS Acyrthosiphon pisum cDNA clon... 72 9e-22 4
(CN754784) ID0AAA14AA07RM1 ApMS Acyrthosiphon pisum cDNA clo... 72 9e-22 4
(AJ229626) Kluyveromyces lactis DNA fragment for sequence ta... 101 1e-21 2
(DW012870) w18d19_M13F Myzus persicae, tobacco lineage, whol... 76 3e-21 4
(FC820732) Sr_pAMT7_018j17_T7 S. ratti mixed stage pAMP Stro... 78 3e-21 5
(BJ347624) Dictyostelium discoideum cDNA clone:dda27l15, 3' ... 72 5e-21 3
(DY895465) CeleSEQ15305 Cunninghamella elegans pBluescript (... 70 1e-20 5
(FE266132) CAZO4933.fwd CAZO Naegleria gruberi Flagellate St... 72 1e-20 4
(EX149107) ZRB166R ZRB Zoophthora radicans cDNA clone ZRB166... 52 5e-20 5
(FE266131) CAZO4933.rev CAZO Naegleria gruberi Flagellate St... 72 5e-20 4
(DJ131610) Method for identification of useful proteins deri... 52 5e-20 5
(AM809607) Nicotiana tabacum EST, clone nt005025061. 56 6e-20 4
(EE570402) E06_E06fm4k11_pDNRf_533092 Myzus persicae, line F... 76 1e-19 3
(CU435554) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 2e-19 6
(CR382126) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 101 3e-19 16
(EU444263) Saccharomyces paradoxus strain CBS8436 CIT2 gene,... 50 8e-19 5
(DV182326) CT005_G02_040112_3700_91.ab1 C. tentans tissue cu... 92 1e-18 2
(AY144918) Saccharomyces castellii clone Contig1542 CIT1 gen... 54 2e-18 5
(DY894605) CeleSEQ14216 Cunninghamella elegans pBluescript (... 70 3e-18 4
(CX615592) GABR1_21_C10.b1_A002 GA- or brassinolide-treated ... 58 3e-18 4
(BJ436097) Dictyostelium discoideum cDNA clone:ddv29o24, 3' ... 105 5e-18 1
(EU444270) Saccharomyces paradoxus strain CBS8444 CIT2 gene,... 50 7e-18 5
(EU444269) Saccharomyces paradoxus strain CBS8442 CIT2 gene,... 50 7e-18 5
(EU444268) Saccharomyces paradoxus strain CBS8441 CIT2 gene,... 50 7e-18 5
(EU444267) Saccharomyces paradoxus strain CBS8440 CIT2 gene,... 50 7e-18 5
(EU444266) Saccharomyces paradoxus strain CBS8439 CIT2 gene,... 50 7e-18 5
(EU444265) Saccharomyces paradoxus strain CBS8438 CIT2 gene,... 50 7e-18 5
(EU444264) Saccharomyces paradoxus strain CBS8437 CIT2 gene,... 50 7e-18 5
(EU444271) Saccharomyces cariocanus strain CBS8841 CIT2 gene... 56 2e-17 4
(EE009853) ROE00001767 Rhizopus oryzae Company Rhizopus oryz... 56 3e-17 4
(AZ932267) 474.dhz96g02.s1 Saccharomyces unisporus NRRL Y-15... 78 4e-17 3
(EJ574973) 1092960089453 Global-Ocean-Sampling_GS-29-01-01-1... 52 8e-17 3
(BJ427996) Dictyostelium discoideum cDNA clone:ddv10k07, 3' ... 101 9e-17 1
(FC816722) Sr_pAMT7_06o17_T7 S. ratti mixed stage pAMP Stron... 78 3e-16 4
(FC811231) Sr_pASP6_06o17_SP6 S. ratti mixed stage pAMP Stro... 78 4e-16 4
(FC815975) Sr_pAMT7_04l20_T7 S. ratti mixed stage pAMP Stron... 78 4e-16 4
(EU519446) Saccharomyces paradoxus strain Q15.1 chromosome I... 64 4e-16 7
(EU519443) Saccharomyces paradoxus strain Q4.1 chromosome II... 64 4e-16 7
(FC810550) Sr_pASP6_04l20_SP6 S. ratti mixed stage pAMP Stro... 78 5e-16 4
(EU519448) Saccharomyces paradoxus strain T18.2 chromosome I... 64 5e-16 7
(EU519445) Saccharomyces paradoxus strain Q14.4 chromosome I... 64 5e-16 7
(EU519444) Saccharomyces paradoxus strain Q6.1 chromosome II... 64 5e-16 7
(EU519447) Saccharomyces paradoxus strain Q43.5 chromosome I... 64 5e-16 7
(EU519451) Saccharomyces paradoxus strain T62.1 chromosome I... 64 5e-16 7
(EU519453) Saccharomyces paradoxus strain T76.6 chromosome I... 64 5e-16 7
(EU519452) Saccharomyces paradoxus strain T68.2 chromosome I... 64 5e-16 7
(EU519450) Saccharomyces paradoxus strain T32.1 chromosome I... 64 6e-16 7
(EU519449) Saccharomyces paradoxus strain T26.3 chromosome I... 64 6e-16 7
(EX148711) ZRA373F ZRA Zoophthora radicans cDNA clone ZRA373... 52 7e-16 4
(ES218168) MpFVN_ag3_A13 Myzus persicae, line F001, PLRV fre... 76 4e-15 2
(BI074105) kt40a08.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 78 1e-14 3
(DJ025882) Genome-wide DNA marker of Saccharomyces cerevisiae. 62 1e-14 3
(T36365) EST101292 S. cerevisiae strain X2180-1A Saccharomyc... 62 2e-14 3
(CZ283897) cp32d06.f Candida parapsilosis Random Genomic Lib... 52 2e-14 4
(BI502289) kt87g01.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 78 3e-14 3
(CR382138) Debaryomyces hansenii strain CBS767 chromosome F ... 68 3e-14 17
(FF084713) CPAD-aab29e05.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 4e-14 5
(FF101975) CPAD-aab91b01.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 5e-14 5
(FF098219) CPAD-aac03h07.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 6e-14 5
(FF094304) CPAD-aac51a03.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 7e-14 5
(FF107502) CPAD-aad63a05.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 7e-14 5
(EE001247) ROE00010959 Rhizopus oryzae Company Rhizopus oryz... 56 9e-14 4
(AY692837) Saccharomyces cerevisiae clone FLH113521.01X YCR0... 64 4e-13 4
(FF101841) CPAD-aab82f04.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 4e-13 5
(M14686) Yeast (S.cerevisiae) CIT2 gene encoding the cytopla... 64 7e-13 4
(FF084849) CPAD-aaa90h11.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 9e-13 5
(EE571058) C10_C10fv4b19_pDNRf_531394 Myzus persicae, line F... 68 9e-13 2
(EC761242) PSE00002688 rw_mgpallid Polysphondylium pallidum ... 54 9e-13 3
(EU444725) Saccharomyces cariocanus strain CBS8841 chromosom... 56 2e-12 2
(EU519441) Saccharomyces paradoxus strain CBS8441 chromosome... 50 3e-12 7
(EU519440) Saccharomyces paradoxus strain CBS8440 chromosome... 50 3e-12 7
(DW012437) w16p13_M13F Myzus persicae, tobacco lineage, whol... 76 4e-12 2
(EU519436) Saccharomyces paradoxus strain CBS8436 chromosome... 50 4e-12 8
(EU519437) Saccharomyces paradoxus strain CBS8437 chromosome... 50 4e-12 8
(EU444726) Saccharomyces paradoxus strain CBS8442 chromosome... 50 5e-12 8
(EU519439) Saccharomyces paradoxus strain CBS8439 chromosome... 50 5e-12 8
(EU519438) Saccharomyces paradoxus strain CBS8438 chromosome... 50 5e-12 8
(AL429961) clone BA0AB034H01 of library BA0AB from strain CL... 68 8e-12 3
(FD510778) C4_TOmix_Q0E03_TW C4_TOmix Caenorhabditis brenner... 52 2e-11 5
(FF103902) CPAD-aad37f03.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 2e-11 4
(EC998666) ROE00008050 Rhizopus oryzae Company Rhizopus oryz... 56 2e-11 3
(FD510776) C4_TOmix_O0E03_TW C4_TOmix Caenorhabditis brenner... 52 2e-11 5
(EU519442) Saccharomyces paradoxus strain CBS8444 chromosome... 50 3e-11 7
(EX265885) 1446376_5_M22_083 PY06 Carica papaya cDNA, mRNA s... 58 3e-11 4
(EX290553) 1578566_5_M20_068 PY06 Carica papaya cDNA, mRNA s... 58 4e-11 4
(EX274679) 1455733_5_C19_078 PY06 Carica papaya cDNA, mRNA s... 58 4e-11 4
(EH017012) USDA-FP_189456 Lysiphlebus testaceipes adult whol... 44 4e-11 4
(FF084011) CPAD-aaa10d02.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 4e-11 4
(EE000645) ROE00007955 Rhizopus oryzae Company Rhizopus oryz... 56 4e-11 3
(EX272565) 1453013_5_B11_048 PY06 Carica papaya cDNA, mRNA s... 58 4e-11 4
(EX272256) 1452917_5_N11_036 PY06 Carica papaya cDNA, mRNA s... 58 4e-11 4
(BF015069) kq60h04.y1 TBN95TM-SSR Strongyloides stercoralis ... 74 4e-11 2
(EE002168) ROE00003154 Rhizopus oryzae Company Rhizopus oryz... 56 4e-11 3
(EE002208) ROE00003564 Rhizopus oryzae Company Rhizopus oryz... 56 4e-11 3
(AB001565) Candida tropicalis DNA for citrate synthase, comp... 38 4e-11 6
(DJ208717) Method for identification of useful proteins deri... 64 5e-11 3
(CR380954) Candida glabrata strain CBS138 chromosome H compl... 70 5e-11 13
(EE009528) ROE00005474 Rhizopus oryzae Company Rhizopus oryz... 56 6e-11 3
(EE007481) ROE00003506 Rhizopus oryzae Company Rhizopus oryz... 56 6e-11 3
(EH641310) EST12418 LK04 Laupala kohalensis cDNA clone 10610... 68 7e-11 2
(EA376382) Sequence 25205 from patent US 7314974. 56 7e-11 4
(EE009515) ROE00005838 Rhizopus oryzae Company Rhizopus oryz... 56 8e-11 3
(DY889887) CeleSEQ6859 Cunninghamella elegans pBluescript (E... 46 1e-10 5
(DV604130) EST1207126 Glossina morsitans morsitans Fat body ... 44 1e-10 5
(FF097634) CPAD-aac14f11.b1 PB2801_EST_CPAD1 Caenorhabditis ... 50 1e-10 4
(DL130880) Bax-responsive genes for drug target identificati... 56 2e-10 4
(AX536470) Sequence 71 from Patent WO02064766. 56 2e-10 4
(AR941440) Sequence 71 from patent US 7101990. 56 2e-10 4
(CB283207) BT1478 Blomia tropicalis cDNA library Blomia trop... 50 4e-10 5
(DQ374006) Glossina morsitans morsitans ATP citrate synthase... 44 5e-10 5
(EH012068) USDA-FP_185005 Lysiphlebus testaceipes adult whol... 42 6e-10 4
(CF601952) tac44g04.x1 Hydra EST -IV Hydra magnipapillata cD... 62 8e-10 3
(FE844892) CAFH671.rev CAFH Pichia stipitis aerobic dextrose... 50 8e-10 4
(FE846464) CAFI748.rev CAFI Pichia stipitis aerobic dextrose... 50 8e-10 4
(FC660325) CAXW17660.rev CAXW Lottia gigantea from female go... 56 9e-10 3
(FE855399) CAFT850.rev CAFT Pichia stipitis oxygen limited d... 50 9e-10 4
(FG085342) CMRC-FF-IH0-aca-g-15-0-CMRC.r1 Ceratitis capitata... 42 9e-10 5
(FC741563) CBBI12543.rev CBBI Lottia gigantea 26h,37h,61h La... 56 1e-09 3
(FC741728) CBBI12641.rev CBBI Lottia gigantea 26h,37h,61h La... 56 1e-09 3
(FC733151) CBBG7698.rev CBBG Lottia gigantea 12,15,18h embry... 56 1e-09 3
(FC682390) CAXX1641.fwd CAXX Lottia gigantea from male gonad... 56 1e-09 3
(FC720978) CBBG13754.fwd CBBG Lottia gigantea 12,15,18h embr... 56 1e-09 3
(FC664303) CAXW3751.rev CAXW Lottia gigantea from female gon... 56 1e-09 3
(FC641334) CAXU5340.fwd CAXU Lottia gigantea from female gon... 56 1e-09 3
(FC607541) CAXS3365.fwd CAXS Lottia gigantea from head, foot... 56 1e-09 3
(CN558005) tae46f04.y1 Hydra EST Darmstadt I Hydra magnipapi... 70 2e-09 3
(AW333304) S20A2 AGS-1 Pneumocystis carinii cDNA 3', mRNA se... 46 2e-09 4
(DW621984) CLJ325-E02.x1d-t SHGC-CLJ2 Gasterosteus aculeatus... 40 2e-09 5
(AM719746) Cucumis melo subsp. melo EST, clone PS_12-D04-M13R. 44 3e-09 5
(Z11113) Yeast (S.cerevisiae) CIT2 gene encoding the cytopla... 56 3e-09 4
(FC281725) CAGN2497.fwd CAGN Nematostella vectensis Nemve mi... 40 3e-09 4
(EA377073) Sequence 25896 from patent US 7314974. 58 4e-09 4
(FF104727) CPAD-aad54d11.b1 PB2801_EST_CPAD1 Caenorhabditis ... 52 5e-09 4
(DT987873) CLJ233-H02.x1d-t SHGC-CLJ Gasterosteus aculeatus ... 40 6e-09 5
(DW615054) CLJ284-D01.y1d-s SHGC-CLJ2 Gasterosteus aculeatus... 64 6e-09 3
(AL429256) clone BA0AB030F08 of library BA0AB from strain CL... 64 7e-09 3
(EC999484) ROE00010863 Rhizopus oryzae Company Rhizopus oryz... 56 8e-09 2
(EE002383) ROE00014077 Rhizopus oryzae Company Rhizopus oryz... 56 8e-09 2
(EE000399) ROE00010403 Rhizopus oryzae Company Rhizopus oryz... 56 8e-09 2
(EE000557) ROE00011242 Rhizopus oryzae Company Rhizopus oryz... 56 8e-09 2
(DT987874) CLJ233-H02.y1d-s SHGC-CLJ Gasterosteus aculeatus ... 64 1e-08 3
(EC854466) HDE00004101 Hyperamoeba dachnaya Non-normalized (... 46 1e-08 3
(DB918677) Idiosepius paradoxus cDNA, clone:Ip_aB_032_P14, 5... 70 1e-08 3
(BG592465) EST491143 cSTS Solanum tuberosum cDNA clone cSTS1... 38 1e-08 5
(ES300275) _27Y_G08 Bermudagrass Normalized cDNA Library Cyn... 48 2e-08 3
(EX255776) 1435748_5_C02_013 PY06 Carica papaya cDNA, mRNA s... 48 2e-08 4
(FC641808) CAXU5613.fwd CAXU Lottia gigantea from female gon... 56 2e-08 3
(FC690808) CAXX2202.fwd CAXX Lottia gigantea from male gonad... 56 2e-08 3
(DY861349) ApulSEQ14828 Aureobasidium pullulans pBluescript ... 42 2e-08 5
(BI431795) EST534556 P. infestans-challenged potato leaf, co... 38 2e-08 5
(CN627925) tae86b05.y1 Hydra EST Darmstadt I Hydra magnipapi... 70 3e-08 2
(CN626769) tae99d06.y1 Hydra EST Darmstadt I Hydra magnipapi... 70 3e-08 2
(CN775244) tae71b07.y1 Hydra EST Darmstadt I Hydra magnipapi... 70 3e-08 2
(DV740396) ID0AFF1BC02CM1 ID0AFF Acyrthosiphon pisum cDNA cl... 72 3e-08 2
(T37038) EST102091 S. cerevisiae strain X2180-1A Saccharomyc... 40 3e-08 3
(DW615053) CLJ284-D01.x1d-t SHGC-CLJ2 Gasterosteus aculeatus... 40 4e-08 5
(DV604616) EST1207612 Glossina morsitans morsitans Fat body ... 44 4e-08 4
(DV616003) EST1218999 Glossina morsitans morsitans Fat body ... 44 4e-08 4
(DV611533) EST1214529 Glossina morsitans morsitans Fat body ... 44 4e-08 4
(CN626488) tae99d06.x1 Hydra EST Darmstadt I Hydra magnipapi... 70 4e-08 2
(DV738896) ID0AFF12AA04CM1 ID0AFF Acyrthosiphon pisum cDNA c... 72 4e-08 2
(DV601898) EST1204893 Glossina morsitans morsitans Fat body ... 44 4e-08 4
(CU435688) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 5e-08 5
(CN498133) E09_01317.AB1 Diabrotica virgifera virgifera midg... 44 6e-08 3
(CN756999) ID0AAA1AE04RM1 ApMS Acyrthosiphon pisum cDNA clon... 72 8e-08 1
(FC663687) CAXW3391.fwd CAXW Lottia gigantea from female gon... 56 9e-08 2
(FC754942) CBBI8374.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 56 9e-08 2
(DB912043) Idiosepius paradoxus cDNA, clone:Ip_aB_005_D10, 5... 70 1e-07 2
(ES741221) HTAB-aab11a05.b1 Heterorhabditis_bacteriophora_HT... 38 1e-07 3
(ES412521) HTAB-aaa57d05.b2 Heterorhabditis_bacteriophora_HT... 38 1e-07 3
(ES743460) HTAB-aab29g12.b1 Heterorhabditis_bacteriophora_HT... 38 1e-07 3
(FF680166) HTAN-aaa04a03.b1 Heterorhabditis_bacteriophora_ES... 38 1e-07 3
(ES523621) BIG_AF_31441 Brine Shrimp embryos, 15 hours after... 64 1e-07 2
(CN627022) tae90d09.x1 Hydra EST Darmstadt I Hydra magnipapi... 68 1e-07 2
(ES522499) BIG_AF_30318 Brine Shrimp embryos, 15 hours after... 64 1e-07 2
(FG168421) AGN_RNC005xc07r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 1e-07 4
(CN565380) tag24g03.y1 Hydra EST -Kiel 1 Hydra vulgaris cDNA... 62 1e-07 2
(FG159502) AGN_RNC022xh22r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 2e-07 4
(FG157700) AGN_RNC025xk02r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 2e-07 4
(FG163192) AGN_RNC015xb07r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 2e-07 4
(FG163195) AGN_RNC015xb17r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 2e-07 4
(FG163616) AGN_RNC014xa04r1.ab1 AGN_RNC Nicotiana tabacum cD... 42 2e-07 4
(FC696866) CAXX5778.fwd CAXX Lottia gigantea from male gonad... 48 2e-07 3
(FE846925) CAFI990.rev CAFI Pichia stipitis aerobic dextrose... 50 2e-07 3
(FE843963) CAFH1631.rev CAFH Pichia stipitis aerobic dextros... 50 2e-07 3
(FE843240) CAFH1222.rev CAFH Pichia stipitis aerobic dextros... 50 2e-07 3
(FE859108) CAFX709.rev CAFX Pichia stipitis oxygen limited x... 50 2e-07 3
(FE853289) CAFP2687.fwd CAFP Pichia stipitis aerobic xylose ... 50 2e-07 3
(CU533948) Theobroma cacao, mRNA sequence (KZ0AAK12YC14FM1). 52 2e-07 3
(FE853288) CAFP2687.rev CAFP Pichia stipitis aerobic xylose ... 50 2e-07 3
(BJ452561) Hordeum vulgare subsp. vulgare cv.Akashinriki cDN... 48 3e-07 4
(CN627589) tae86b05.x1 Hydra EST Darmstadt I Hydra magnipapi... 70 3e-07 1
(CB832935) USDA-FP_100963 Adult Alate Brown Citrus Aphid Tox... 52 4e-07 2
(EX054286) BR038930 floral buds cDNA library KBFS Brassica r... 50 6e-07 2
(EV020119) BNSCS2CT_UP_059_C03_18APR2007_027 Brassica napus ... 50 6e-07 2
(EX052027) BR036671 floral buds cDNA library KBFS Brassica r... 50 6e-07 2
(FD571417) RS2FQ33TF RS2(RS) Raphanus sativus cDNA 5', mRNA ... 50 6e-07 2
(EX055011) BR039655 floral buds cDNA library KBFS Brassica r... 50 6e-07 2
(BT006613) Arabidopsis thaliana At2g44350 mRNA, complete cds. 50 7e-07 3
(AX651877) Sequence 746 from Patent WO03000898. 50 7e-07 3
(AX506281) Sequence 976 from Patent WO0216655. 50 7e-07 3
(BW923414) Branchiostoma floridae cDNA, neurula clone:bfne07... 46 8e-07 3
(EX137030) BR120860 root cDNA library KHRT Brassica rapa sub... 50 9e-07 2
(EV173142) 0155773 Brassica napus Etiolated seedlings (Uni-Z... 50 9e-07 2
(DT937755) ZM_BFb0117F20.r ZM_BFb Zea mays cDNA 5', mRNA seq... 46 9e-07 3
(EX268511) 1448900_5_G02_009 PY06 Carica papaya cDNA, mRNA s... 58 9e-07 2
(DY864991) ApulSEQ000762 Aureobasidium pullulans pBluescript... 56 1e-06 3
(BX819832) Arabidopsis thaliana Full-length cDNA Complete se... 50 1e-06 3
>(BJ343985) Dictyostelium discoideum cDNA clone:dda17g21, 3' end,
single read.
Length = 711
Score = 1354 bits (683), Expect = 0.0
Identities = 683/683 (100%)
Strand = Plus / Minus
Query: 886 ctgccaatttcaatcgtatgttgggttacacctcaaaagatttcgatgaactcatgagac 945
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 711 ctgccaatttcaatcgtatgttgggttacacctcaaaagatttcgatgaactcatgagac 652
Query: 946 tttacctcaccattcatactgatcatgaaggtggtaacgttaggtgctcatacaactcat 1005
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 651 tttacctcaccattcatactgatcatgaaggtggtaacgttaggtgctcatacaactcat 592
Query: 1006 ttagtaggttccgccttatctgacagttatttatcattaagtgctggtatgtgtggtctt 1065
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 591 ttagtaggttccgccttatctgacagttatttatcattaagtgctggtatgtgtggtctt 532
Query: 1066 gctggtccattacatggtttagccaatcaagaagtactttcatggacaatgaaattacaa 1125
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 531 gctggtccattacatggtttagccaatcaagaagtactttcatggacaatgaaattacaa 472
Query: 1126 gaaaaattaggaaacaaagaagtctcaaatgaagttttatcagaagccatctgggaaggt 1185
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 471 gaaaaattaggaaacaaagaagtctcaaatgaagttttatcagaagccatctgggaaggt 412
Query: 1186 ttaaacgctggtcgtgttgtaccaggatttggtcatgccgtcttaagaaagactgatcca 1245
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 411 ttaaacgctggtcgtgttgtaccaggatttggtcatgccgtcttaagaaagactgatcca 352
Query: 1246 cgttacacttgtcaacgtgagtttgctcttaaacatttaccacaagatccattattcaaa 1305
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 351 cgttacacttgtcaacgtgagtttgctcttaaacatttaccacaagatccattattcaaa 292
Query: 1306 ttagtcagccaaatctacgaagttgttccagatattttaactaaacacggtaaaaccaag 1365
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 291 ttagtcagccaaatctacgaagttgttccagatattttaactaaacacggtaaaaccaag 232
Query: 1366 aacccatatccaaatgttgatgctcactctggttgtttattacaatactatggcttaaaa 1425
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 231 aacccatatccaaatgttgatgctcactctggttgtttattacaatactatggcttaaaa 172
Query: 1426 gaacataacttctacactgttttattcggtgtttcaagagccattggtgttttatcatca 1485
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 171 gaacataacttctacactgttttattcggtgtttcaagagccattggtgttttatcatca 112
Query: 1486 ttagtttgggatcgtatcttaggtcacccaatcgaaagaccaaaatcagtcaccactgaa 1545
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 111 ttagtttgggatcgtatcttaggtcacccaatcgaaagaccaaaatcagtcaccactgaa 52
Query: 1546 tggatttcatcttacgtaaactc 1568
|||||||||||||||||||||||
Sbjct: 51 tggatttcatcttacgtaaactc 29
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,754,391,415
Number of extensions: 95185069
Number of successful extensions: 7603585
Number of sequences better than 10.0: 2058
Length of query: 1726
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1702
Effective length of database: 96,409,374,237
Effective search space: 164088754951374
Effective search space used: 164088754951374
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 8. 2 |
| Homology vs Protein |
Query= Contig-U16281-1 (Contig-U16281-1Q) /CSM_Contig/Contig-U16281-1Q.Seq.d
(1726 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q553V1) RecName: Full=Citrate synthase, mitochondrial; ... 399 0.0
AC116305_8(AC116305|pid:none) Dictyostelium discoideum chromosom... 398 0.0
(Q7ZWZ5) RecName: Full=Citrate synthase, mitochondrial; ... 265 e-149
(P0C1Z2) RecName: Full=Citrate synthase, mitochondrial; ... 268 e-148
(Q29RK1) RecName: Full=Citrate synthase, mitochondrial; ... 269 e-148
(Q0GNE0) RecName: Full=Citrate synthase, mitochondrial; ... 265 e-147
(Q0GNE1) RecName: Full=Citrate synthase, mitochondrial; ... 265 e-147
BC166040_1(BC166040|pid:none) Danio rerio citrate synthase, mRNA... 261 e-147
AF053631_1(AF053631|pid:none) Homo sapiens citrate synthase mRNA... 268 e-147
(Q6S9V8) RecName: Full=Citrate synthase, mitochondrial; ... 261 e-147
(Q6S9V7) RecName: Full=Citrate synthase, mitochondrial; ... 259 e-147
(P00889) RecName: Full=Citrate synthase, mitochondrial; ... 265 e-146
AF047042_1(AF047042|pid:none) Homo sapiens citrate synthase mRNA... 268 e-146
NRL(1CTS) citrate (si)-synthase (EC 4.1.3.7) (with citrate) - pi... 265 e-146
NRL(2CTS) citrate (si)-synthase (EC 4.1.3.7) (with citrate coenz... 265 e-146
AK005713_1(AK005713|pid:none) Mus musculus adult male testis cDN... 267 e-145
AK161295_1(AK161295|pid:none) Mus musculus adult male testis cDN... 267 e-145
FM992695_315(FM992695|pid:none) Candida dubliniensis CD36 chromo... 255 e-144
AK095856_1(AK095856|pid:none) Homo sapiens cDNA FLJ38537 fis, cl... 268 e-143
FM865901_1(FM865901|pid:none) Brissopsis lyrifera partial mRNA f... 259 e-142
(P00890) RecName: Full=Citrate synthase, mitochondrial; ... 251 e-142
CP000502_263(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 252 e-142
AY144810_1(AY144810|pid:none) Saccharomyces bayanus clone Contig... 247 e-141
AJ296102_1(AJ296102|pid:none) Podospora anserina cit1 gene for m... 257 e-140
BX640838_1(BX640838|pid:none) Homo sapiens mRNA; cDNA DKFZp686D2... 268 e-140
CU928180_527(CU928180|pid:none) Kluyveromyces thermotolerans str... 252 e-140
(P79024) RecName: Full=Citrate synthase, mitochondrial; ... 243 e-140
AJ243204_1(AJ243204|pid:none) Aspergilluse niger citA gene for c... 258 e-139
AM989984_29(AM989984|pid:none) Zygosaccharomyces rouxii strain C... 252 e-139
CR382131_112(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 243 e-139
(P51044) RecName: Full=Citrate synthase, mitochondrial; ... 258 e-139
AF193854_1(AF193854|pid:none) Saccharomyces kluyveri putative ci... 243 e-138
AM920427_540(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 259 e-138
(P34085) RecName: Full=Citrate synthase, mitochondrial; ... 254 e-138
AY816050_1(AY816050|pid:none) Schistosoma japonicum SJCHGC00653 ... 243 e-137
DQ674540_1(DQ674540|pid:none) Coccidioides posadasii citrate syn... 256 e-137
M84187_1(M84187|pid:none) N.crassa mitochondrial citrate synthas... 252 e-137
(P23007) RecName: Full=Citrate synthase, mitochondrial; ... 245 e-137
AY126274_1(AY126274|pid:none) Candida krusei citrate synthase (C... 240 e-136
CR380954_165(CR380954|pid:none) Candida glabrata strain CBS138 c... 246 e-136
AE016814_190(AE016814|pid:none) Ashbya gossypii (= Eremothecium ... 244 e-136
AY085647_1(AY085647|pid:none) Arabidopsis thaliana clone 16528 m... 247 e-136
AP007162_524(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 251 e-135
(O80433) RecName: Full=Citrate synthase, mitochondrial; ... 246 e-135
(P20115) RecName: Full=Citrate synthase 4, mitochondrial; ... 247 e-135
(Q61JF9) RecName: Full=Probable citrate synthase, mitochondrial;... 231 e-130
(P34575) RecName: Full=Probable citrate synthase, mitochondrial;... 229 e-130
EF676654_1(EF676654|pid:none) Picea sitchensis clone WS02746_G08... 250 e-130
AK243001_1(AK243001|pid:none) Oryza sativa Japonica Group cDNA, ... 247 e-129
CP000585_177(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 255 e-129
AB272085_1(AB272085|pid:none) Phanerochaete chrysosporium Cit1 m... 240 e-129
A46546_1(A46546|pid:none) Sequence 2 from Patent WO9524487. &X8... 246 e-129
(P08679) RecName: Full=Citrate synthase, peroxisomal; E... 240 e-127
A46547_1(A46547|pid:none) Sequence 3 from Patent WO9524487. &X8... 233 e-127
CR382138_880(CR382138|pid:none) Debaryomyces hansenii strain CBS... 250 e-125
(Q4QDX3) RecName: Full=Probable citrate synthase, mitochondrial;... 234 e-118
(Q43175) RecName: Full=Citrate synthase, mitochondrial; ... 231 e-117
(A4HXU4) RecName: Full=Probable citrate synthase, mitochondrial;... 233 e-115
AM920435_1351(AM920435|pid:none) Penicillium chrysogenum Wiscons... 202 e-114
AP007150_478(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 200 e-113
(A4H9H8) RecName: Full=Probable citrate synthase, mitochondrial;... 227 e-113
CR380948_153(CR380948|pid:none) Candida glabrata strain CBS138 c... 222 e-113
DQ849026_1(DQ849026|pid:none) Hypocrea jecorina citrate synthase... 196 e-113
AM502236_70(AM502236|pid:none) Leishmania infantum chromosome 18. 225 e-113
CP000251_3658(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 254 e-113
AP006840_2542(AP006840|pid:none) Symbiobacterium thermophilum IA... 249 e-112
AM494955_76(AM494955|pid:none) Leishmania braziliensis chromosom... 223 e-111
DQ992409_1(DQ992409|pid:none) Mus spicilegus citrate synthase-li... 212 e-111
(Q9TEM3) RecName: Full=2-methylcitrate synthase, mitochondrial; ... 198 e-110
CR548612_250(CR548612|pid:none) Paramecium tetraurelia macronucl... 215 e-110
CR382131_22(CR382131|pid:none) Yarrowia lipolytica strain CLIB12... 194 e-110
CU633872_205(CU633872|pid:none) Podospora anserina genomic DNA c... 194 e-109
CP001124_1637(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 239 e-108
CP000698_1554(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 238 e-107
AY490258_1(AY490258|pid:none) Geobacter metallireducens citrate ... 230 e-104
AE014297_1491(AE014297|pid:none) Drosophila melanogaster chromos... 220 e-104
DQ992407_1(DQ992407|pid:none) Mus caroli citrate synthase-like p... 213 e-102
CP000482_1117(CP000482|pid:none) Pelobacter propionicus DSM 2379... 225 e-100
AY223083_1(AY223083|pid:none) Schistosoma japonicum clone ZZD131... 214 2e-96
EF489424_1(EF489424|pid:none) Toxoplasma gondii mitochondrial ci... 214 5e-95
CR382125_620(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 185 1e-92
CR940348_292(CR940348|pid:none) Theileria annulata strain Ankara... 187 8e-89
BT054477_1(BT054477|pid:none) Zea mays full-length cDNA clone ZM... 238 1e-88
AY069260_1(AY069260|pid:none) Drosophila melanogaster GM05016 fu... 262 6e-87
AE016820_370(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 176 8e-85
AY144919_1(AY144919|pid:none) Saccharomyces castellii clone Cont... 177 3e-83
AM910988_67(AM910988|pid:none) Plasmodium knowlesi strain H chro... 181 2e-81
DQ403126_1(DQ403126|pid:none) Rattus norvegicus citrate synthase... 261 6e-81
NRL(5CSCB1) citrate (si)-synthase (EC 4.1.3.7), chain B, fragmen... 208 9e-80
NRL(1CSC1) citrate (si)-synthase (EC 4.1.3.7) (with L-malate &N... 207 1e-79
DQ403122_1(DQ403122|pid:none) Loxodonta africana citrate synthas... 251 4e-79
DQ403129_1(DQ403129|pid:none) Lepus europaeus citrate synthase (... 252 5e-79
DQ403130_1(DQ403130|pid:none) Oryctolagus cuniculus citrate synt... 250 7e-79
DQ403128_1(DQ403128|pid:none) Cavia porcellus citrate synthase (... 249 9e-79
DQ403132_1(DQ403132|pid:none) Homo sapiens citrate synthase (CS)... 249 2e-78
DQ403120_1(DQ403120|pid:none) Didelphis virginiana citrate synth... 251 2e-78
DQ403131_1(DQ403131|pid:none) Tadarida brasiliensis citrate synt... 248 3e-78
DQ403125_1(DQ403125|pid:none) Mus musculus citrate synthase (CS)... 247 4e-78
DQ403140_1(DQ403140|pid:none) Bos taurus citrate synthase (CS) m... 246 2e-77
DQ403121_1(DQ403121|pid:none) Sminthopsis douglasi citrate synth... 248 2e-77
DQ403134_1(DQ403134|pid:none) Tupaia glis citrate synthase (CS) ... 244 3e-77
DQ403142_1(DQ403142|pid:none) Hippopotamus amphibius citrate syn... 244 4e-77
DQ403124_1(DQ403124|pid:none) Tamandua tetradactyla citrate synt... 244 1e-76
DQ403136_1(DQ403136|pid:none) Felis catus citrate synthase (CS) ... 243 1e-76
AK072950_1(AK072950|pid:none) Oryza sativa Japonica Group cDNA c... 247 1e-76
DQ403133_1(DQ403133|pid:none) Aotus trivirgatus citrate synthase... 242 1e-76
DQ403127_1(DQ403127|pid:none) Mesocricetus auratus citrate synth... 242 2e-76
FN392319_422(FN392319|pid:none) Pichia pastoris GS115 chromosome... 247 7e-76
DQ403123_1(DQ403123|pid:none) Dasypus novemcinctus citrate synth... 240 2e-75
T09334(T09334) citrate (si)-synthase (EC 4.1.3.7), mitochondrial... 246 1e-74
DQ403119_1(DQ403119|pid:none) Monodelphis domestica citrate synt... 237 5e-74
DQ403135_1(DQ403135|pid:none) Canis familiaris citrate synthase ... 232 2e-73
EF414562_1(EF414562|pid:none) Uncultured Geobacter sp. clone PLY... 134 5e-68
AY490262_1(AY490262|pid:none) Geobacter bemidjiensis citrate syn... 158 6e-66
AY490263_1(AY490263|pid:none) Desulfuromonas acetexigens citrate... 159 2e-65
AK293263_1(AK293263|pid:none) Homo sapiens cDNA FLJ55186 complet... 195 6e-63
AY144996_1(AY144996|pid:none) Saccharomyces kluyveri clone Conti... 182 2e-58
NRL(5CSCA2) citrate (si)-synthase (EC 4.1.3.7), chain A, fragmen... 129 4e-56
FJ814766_1(FJ814766|pid:none) Camellia sinensis cultivar Huanggu... 195 7e-54
EZ000444_1(EZ000444|pid:none) TSA: Culex tarsalis Ctar-290 citra... 213 1e-53
EU677704_1(EU677704|pid:none) Caenorhabditis brenneri mitochondr... 208 6e-53
FJ872394_1(FJ872394|pid:none) Glycine max cultivar Jiyu 70 putat... 162 2e-51
CU928178_181(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 174 3e-50
BT055772_1(BT055772|pid:none) Zea mays full-length cDNA clone ZM... 198 6e-49
AM426219_2(AM426219|pid:none) Vitis vinifera contig VV79X005739.... 184 1e-44
AF461103_1(AF461103|pid:none) Bos taurus citrate synthase mRNA, ... 182 3e-44
DQ059757_1(DQ059757|pid:none) Gadus morhua citrate synthase (CIS... 84 7e-39
AB057662_1(AB057662|pid:none) Sesbania rostrata SrCS mRNA for ci... 83 1e-36
AM263442_1(AM263442|pid:none) Lubomirskia baicalensis partial mR... 156 3e-36
BX908798_1771(BX908798|pid:none) Parachlamydia-related symbiont ... 114 2e-26
AX172589_1(AX172589|pid:none) Sequence 79 from Patent WO0144476. 114 1e-23
AM262925_1(AM262925|pid:none) Phillyrea latifolia partial mRNA f... 106 2e-21
EU857821_1(EU857821|pid:none) Chaenocephalus aceratus citrate sy... 84 2e-19
CP000852_300(CP000852|pid:none) Caldivirga maquilingensis IC-167... 62 1e-16
NRL(5CSCA1) citrate (si)-synthase (EC 4.1.3.7), chain A, fragmen... 86 3e-15
CP000240_1860(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 56 9e-15
AB359458_1(AB359458|pid:none) Rickettsia sp. TCM1 gltA gene for ... 63 9e-15
CP000766_1320(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 62 2e-14
(P51040) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 62 3e-14
CP001612_981(CP001612|pid:none) Rickettsia africae ESF-5, comple... 61 3e-14
AY743327_1(AY743327|pid:none) Rickettsia japonica GltA (gltA) ge... 61 3e-14
AF178035_1(AF178035|pid:none) Rickettsia sp. BJ-90 citrate synth... 61 3e-14
GQ255903_1(GQ255903|pid:none) Rickettsia sp. SGL01 citrate synth... 61 4e-14
AB444098_1(AB444098|pid:none) Rickettsia sp. GRA-1 gltA gene for... 61 4e-14
(Q59730) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 58 4e-14
(P51042) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 60 6e-14
AF140706_1(AF140706|pid:none) Rickettsia sp. IRS3 citrate syntha... 59 8e-14
(Q59759) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 60 1e-13
(P51039) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 59 1e-13
(Q59742) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 60 1e-13
EF219460_1(EF219460|pid:none) Rickettsia sp. IG-1 citrate syntha... 60 1e-13
DQ365806_1(DQ365806|pid:none) Candidatus Rickettsia kulagini str... 60 2e-13
AF210692_1(AF210692|pid:none) Rickettsia sp. California 2 citrat... 59 2e-13
U59735_1(U59735|pid:none) Rickettsia sp. Strain S citrate syntha... 59 2e-13
AF394897_1(AF394897|pid:none) Rickettsia sp. DT1 citrate synthas... 59 3e-13
EF219463_1(EF219463|pid:none) Rickettsia sp. TwKM01 citrate synt... 58 3e-13
U59730_1(U59730|pid:none) Rickettsia conorii Seven citrate synth... 58 4e-13
(P51041) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 57 4e-13
U59729_1(U59729|pid:none) Rickettsia rickettsii R (Bitterroot) c... 57 8e-13
AY375163_1(AY375163|pid:none) Rickettsia amblyommii citrate synt... 60 8e-13
CP000382_1765(CP000382|pid:none) Clostridium novyi NT, complete ... 53 9e-13
(Q1RGV8) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 59 1e-12
EF451001_1(EF451001|pid:none) Rickettsia sp. 'Argentina' citrate... 60 1e-12
AM889285_1830(AM889285|pid:none) Gluconacetobacter diazotrophicu... 77 3e-12
EF102236_1(EF102236|pid:none) Rickettsia parkeri strain At24 cit... 59 4e-12
DQ865206_1(DQ865206|pid:none) Rickettsia rhipicephali strain HJ5... 58 6e-12
EU567181_1(EU567181|pid:none) Rickettsia bellii strain Pontal ci... 57 8e-12
DQ517288_1(DQ517288|pid:none) Rickettsia bellii strain An4 citra... 57 8e-12
AY362703_1(AY362703|pid:none) Rickettsia bellii citrate synthase... 56 1e-11
U76908_1(U76908|pid:none) Rickettsia sp. citrate synthase (gltA)... 56 1e-11
DQ496220_1(DQ496220|pid:none) Citrus sinensis cultivar Bonanza m... 54 2e-11
U59714_1(U59714|pid:none) Rickettsia typhi Wilmington citrate sy... 58 2e-11
AY259084_1(AY259084|pid:none) Rickettsia aeschlimannii citrate s... 52 2e-11
CR954246_1612(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 74 2e-11
CP000444_1692(CP000444|pid:none) Shewanella sp. MR-7, complete g... 74 2e-11
AY375161_1(AY375161|pid:none) Rickettsia bellii citrate synthase... 58 2e-11
CP000702_613(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 73 3e-11
CP000469_1693(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 73 3e-11
CP000447_2331(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 73 4e-11
AJ269522_1(AJ269522|pid:none) Male-killing Rickettsia from Adali... 54 4e-11
CP000749_2774(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 72 5e-11
CP000503_1718(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 72 6e-11
(P20901) RecName: Full=Citrate synthase; EC=2.3.3.1; Al... 72 6e-11
DQ631551_1(DQ631551|pid:none) Acetobacter aceti strain 1023 citr... 72 6e-11
CP000302_2173(CP000302|pid:none) Shewanella denitrificans OS217,... 72 8e-11
CP000284_61(CP000284|pid:none) Methylobacillus flagellatus KT, c... 72 8e-11
AP009386_673(AP009386|pid:none) Burkholderia multivorans ATCC 17... 71 1e-10
AM286690_1501(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 71 1e-10
CP000083_2157(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 71 1e-10
CU633749_2072(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 71 1e-10
CP001601_765(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 71 1e-10
CP001026_722(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 70 2e-10
CP000615_1079(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 70 2e-10
AF516333_1(AF516333|pid:none) Rickettsia sp. RF2125 citrate synt... 49 2e-10
DQ115890_1(DQ115890|pid:none) Rickettsia rickettsii strain Taiac... 53 2e-10
CP001504_745(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 70 2e-10
CP000085_662(CP000085|pid:none) Burkholderia thailandensis E264 ... 70 2e-10
CP000510_2127(CP000510|pid:none) Psychromonas ingrahamii 37, com... 70 2e-10
CP000394_896(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 70 3e-10
DQ865204_1(DQ865204|pid:none) Rickettsia bellii strain HJ7 citra... 51 3e-10
CP000680_2489(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 69 4e-10
AP009044_956(AP009044|pid:none) Corynebacterium glutamicum R DNA... 69 4e-10
CP000352_2472(CP000352|pid:none) Ralstonia metallidurans CH34, c... 69 4e-10
CP000613_1158(CP000613|pid:none) Rhodospirillum centenum SW, com... 69 4e-10
AF497584_1(AF497584|pid:none) Rickettsia sp. RDa420 citrate synt... 51 4e-10
CP000821_2813(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 69 5e-10
CP000471_887(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 69 5e-10
CP001635_1413(CP001635|pid:none) Variovorax paradoxus S110 chrom... 69 5e-10
CP001157_2880(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 69 5e-10
BX248356_64(BX248356|pid:none) Corynebacterium diphtheriae gravi... 69 5e-10
DQ269435_1(DQ269435|pid:none) Candidatus Rickettsia gravesii cit... 54 5e-10
(P42457) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 69 7e-10
FM954972_2130(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 69 7e-10
AM181176_1774(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 69 7e-10
CP000462_1871(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 69 7e-10
AX065419_1(AX065419|pid:none) Sequence 545 from Patent WO0100844... 69 7e-10
CP000090_2300(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 69 7e-10
CP001103_1854(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 69 7e-10
CP000094_1608(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 69 7e-10
DQ150692_1(DQ150692|pid:none) Rickettsia rickettsii strain 1995H... 47 9e-10
AM398681_1272(AM398681|pid:none) Flavobacterium psychrophilum JI... 68 9e-10
CP000076_1687(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 68 9e-10
CP000949_3494(CP000949|pid:none) Pseudomonas putida W619, comple... 68 1e-09
CS431060_1(CS431060|pid:none) Sequence 89 from Patent EP1710313.... 68 1e-09
AB082520_1(AB082520|pid:none) Corynebacterium efficiens gltA2 ge... 68 1e-09
CP000020_811(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 68 1e-09
CP000712_1639(CP000712|pid:none) Pseudomonas putida F1, complete... 68 1e-09
CP000931_2475(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 68 1e-09
CP000472_2831(CP000472|pid:none) Shewanella piezotolerans WP3, c... 68 1e-09
AE015451_4141(AE015451|pid:none) Pseudomonas putida KT2440 compl... 68 1e-09
AX647845_1(AX647845|pid:none) Sequence 2037 from Patent EP1270724. 68 1e-09
CP001053_2769(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 67 2e-09
CP000851_1777(CP000851|pid:none) Shewanella pealeana ATCC 700345... 67 2e-09
CP000606_1644(CP000606|pid:none) Shewanella loihica PV-4, comple... 67 2e-09
CS431062_1(CS431062|pid:none) Sequence 91 from Patent EP1710313.... 67 2e-09
(P49299) RecName: Full=Citrate synthase, glyoxysomal; E... 67 2e-09
CP000271_137(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 67 2e-09
(P51034) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 67 2e-09
AE016853_2155(AE016853|pid:none) Pseudomonas syringae pv. tomato... 67 2e-09
AE017340_1502(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 67 2e-09
CP000685_365(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 67 2e-09
CP000644_2194(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 67 2e-09
AE002098_921(AE002098|pid:none) Neisseria meningitidis MC58, com... 67 3e-09
CP000697_1706(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 67 3e-09
CP000267_1763(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 67 3e-09
AL954747_2375(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 66 4e-09
CP000941_806(CP000941|pid:none) Xylella fastidiosa M12, complete... 66 4e-09
CP001020_1319(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 66 5e-09
EU567177_1(EU567177|pid:none) Rickettsia sp. NOD citrate synthas... 48 6e-09
AE009442_711(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 65 6e-09
AL646052_1990(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 65 6e-09
CP000890_1348(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 65 6e-09
(P18789) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 65 6e-09
CR931997_426(CR931997|pid:none) Corynebacterium jeikeium K411 co... 65 6e-09
(P14165) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 65 6e-09
CP001562_644(CP001562|pid:none) Bartonella grahamii as4aup, comp... 65 6e-09
AM260525_822(AM260525|pid:none) Bartonella tribocorum CIP 105476... 65 6e-09
CP000884_2413(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 65 6e-09
M29728_1(M29728|pid:none) P.aeruginosa NADH-sensitive citrate sy... 65 6e-09
CP001291_3988(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 62 7e-09
CP000304_1836(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 65 8e-09
AP008230_4425(AP008230|pid:none) Desulfitobacterium hafniense Y5... 65 8e-09
CP000504_1659(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 60 1e-08
CP000667_2102(CP000667|pid:none) Salinispora tropica CNB-440, co... 65 1e-08
CP000511_4943(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 65 1e-08
CP000655_759(CP000655|pid:none) Polynucleobacter necessarius sub... 65 1e-08
BX548175_2598(BX548175|pid:none) Prochlorococcus marinus MIT9313... 65 1e-08
CP000859_26(CP000859|pid:none) Desulfococcus oleovorans Hxd3, co... 61 1e-08
CP000964_3770(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 64 1e-08
CU207211_1676(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 64 1e-08
CP000850_2206(CP000850|pid:none) Salinispora arenicola CNS-205, ... 64 1e-08
CP000656_1713(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 64 1e-08
AB334779_1(AB334779|pid:none) Glycine max mRNA for peroxisomal c... 64 1e-08
(Q9SJH7) RecName: Full=Citrate synthase 3, peroxisomal; ... 64 1e-08
DQ372954_1(DQ372954|pid:none) Candidatus Rickettsia antechini ci... 46 2e-08
AM942444_1557(AM942444|pid:none) Corynebacterium urealyticum DSM... 64 2e-08
AE017126_185(AE017126|pid:none) Prochlorococcus marinus subsp. m... 64 2e-08
AP008955_431(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 64 2e-08
BX294144_201(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 64 2e-08
CR954217_232(CR954217|pid:none) Ostreococcus tauri strain OTTH05... 64 2e-08
AE017283_1408(AE017283|pid:none) Propionibacterium acnes KPA1712... 64 2e-08
CP000285_1202(CP000285|pid:none) Chromohalobacter salexigens DSM... 64 2e-08
CP000660_2163(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 60 3e-08
BA000023_641(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 63 3e-08
AM286415_2806(AM286415|pid:none) Yersinia enterocolitica subsp. ... 63 3e-08
CP000783_2558(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 63 3e-08
CP001010_902(CP001010|pid:none) Polynucleobacter necessarius sub... 63 3e-08
CP000439_1587(CP000439|pid:none) Francisella tularensis subsp. n... 63 3e-08
CP000653_1212(CP000653|pid:none) Enterobacter sp. 638, complete ... 63 3e-08
CP000283_2831(CP000283|pid:none) Rhodopseudomonas palustris BisB... 63 3e-08
CU928158_2304(CU928158|pid:none) Escherichia fergusonii ATCC 354... 63 3e-08
CP000266_578(CP000266|pid:none) Shigella flexneri 5 str. 8401, c... 63 3e-08
CP000524_568(CP000524|pid:none) Bartonella bacilliformis KC583, ... 63 4e-08
AE008923_3339(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 63 4e-08
AM942759_557(AM942759|pid:none) Proteus mirabilis strain HI4320,... 63 4e-08
AP008229_1051(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 63 4e-08
CP000084_1135(CP000084|pid:none) Candidatus Pelagibacter ubique ... 63 4e-08
AE008922_3186(AE008922|pid:none) Xanthomonas campestris pv. camp... 63 4e-08
CP000911_1136(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 62 5e-08
AE016958_829(AE016958|pid:none) Mycobacterium avium subsp. parat... 62 5e-08
CP001577_287(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 62 5e-08
CP001349_1464(CP001349|pid:none) Methylobacterium nodulans ORS 2... 62 5e-08
AY578115_1(AY578115|pid:none) Candidatus Rickettsia principis fr... 62 5e-08
CP000155_4527(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 62 7e-08
(P0ABH7) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 62 7e-08
CP000596_228(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 62 7e-08
CP000514_1132(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 62 7e-08
A99722(A99722) citrate synthase [imported] - Escherichia coli (s... 62 7e-08
CP001339_1282(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 62 7e-08
AE005174_744(AE005174|pid:none) Escherichia coli O157:H7 EDL933,... 62 7e-08
CP000250_2803(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 62 7e-08
CR543861_2608(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 62 9e-08
CP000943_619(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 62 9e-08
CP001154_2403(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 62 9e-08
AE016825_1070(AE016825|pid:none) Chromobacterium violaceum ATCC ... 62 9e-08
CP000490_867(CP000490|pid:none) Paracoccus denitrificans PD1222 ... 62 9e-08
CP000880_2135(CP000880|pid:none) Salmonella enterica subsp. ariz... 61 1e-07
AE005176_670(AE005176|pid:none) Lactococcus lactis subsp. lactis... 61 1e-07
AE005673_1893(AE005673|pid:none) Caulobacter crescentus CB15, co... 61 1e-07
DQ365803_1(DQ365803|pid:none) Rickettsia raoultii strain Marne c... 61 1e-07
AE017220_736(AE017220|pid:none) Salmonella enterica subsp. enter... 61 1e-07
DQ124930_1(DQ124930|pid:none) Rickettsia sibirica citrate syntha... 48 1e-07
CP000230_1595(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 61 1e-07
CR522870_1088(CR522870|pid:none) Desulfotalea psychrophila LSv54... 61 1e-07
BX571863_215(BX571863|pid:none) Photorhabdus luminescens subsp. ... 61 1e-07
CP000777_989(CP000777|pid:none) Leptospira biflexa serovar Patoc... 61 1e-07
AK120755_1(AK120755|pid:none) Oryza sativa Japonica Group cDNA c... 61 1e-07
CP000435_2575(CP000435|pid:none) Synechococcus sp. CC9311, compl... 61 1e-07
CP000713_255(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 61 1e-07
(Q59136) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 61 1e-07
FM211057_109(FM211057|pid:none) Photorhabdus asymbiotica subsp. ... 60 2e-07
CU459003_710(CU459003|pid:none) Magnetospirillum gryphiswaldense... 60 2e-07
CP000774_3164(CP000774|pid:none) Parvibaculum lavamentivorans DS... 60 2e-07
CT978603_2276(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 60 2e-07
AE017282_803(AE017282|pid:none) Methylococcus capsulatus str. Ba... 60 2e-07
CP000561_550(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 59 2e-07
AB297808_1(AB297808|pid:none) Rickettsia asiatica gltA gene for ... 60 3e-07
AM233362_1788(AM233362|pid:none) Francisella tularensis subsp. h... 60 3e-07
AB297810_1(AB297810|pid:none) Rickettsia asiatica gltA gene for ... 60 3e-07
CP000915_114(CP000915|pid:none) Francisella tularensis subsp. me... 60 3e-07
CU928162_669(CU928162|pid:none) Escherichia coli ED1a chromosome... 60 3e-07
CP000878_179(CP000878|pid:none) Prochlorococcus marinus str. MIT... 60 3e-07
CP000608_116(CP000608|pid:none) Francisella tularensis subsp. tu... 60 3e-07
AE017223_1070(AE017223|pid:none) Brucella abortus biovar 1 str. ... 60 3e-07
AE008917_835(AE008917|pid:none) Brucella melitensis 16M chromoso... 60 3e-07
CP000661_3063(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 60 3e-07
CP001400_2538(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 60 3e-07
CP000822_2377(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 60 3e-07
AM778914_28(AM778914|pid:none) Microcystis aeruginosa PCC 7806 g... 60 3e-07
AE014613_2015(AE014613|pid:none) Salmonella enterica subsp. ente... 60 3e-07
CP000542_1370(CP000542|pid:none) Verminephrobacter eiseniae EF01... 60 3e-07
(P94325) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 60 3e-07
AE009441_1166(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 58 4e-07
AF1834(AF1834) citrate synthase [imported] - Nostoc sp. (strain ... 56 4e-07
AJ012408_2(AJ012408|pid:none) Anabaena sp. PCC 7120 gltA gene an... 56 4e-07
DQ402514_1(DQ402514|pid:none) Candidatus Rickettsia uilenbergi c... 59 4e-07
CP001287_1330(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 59 4e-07
CR628336_1373(CR628336|pid:none) Legionella pneumophila str. Par... 59 4e-07
EF689743_1(EF689743|pid:none) Francisella sp. TX119 GltA gene, p... 59 4e-07
AP008957_4612(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 59 4e-07
AM743169_3623(AM743169|pid:none) Stenotrophomonas maltophilia K2... 59 6e-07
U76375_1(U76375|pid:none) Bradyrhizobium japonicum citrate synth... 59 6e-07
CP000453_2733(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 59 6e-07
CP001616_2198(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 59 6e-07
CP001100_611(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 59 6e-07
CU207366_2770(CU207366|pid:none) Gramella forsetii KT0803 comple... 59 6e-07
CP000660_996(CP000660|pid:none) Pyrobaculum arsenaticum DSM 1351... 59 6e-07
EU359287_1(EU359287|pid:none) Rickettsia helvetica isolate 41-2 ... 59 6e-07
DQ513394_1(DQ513394|pid:none) Ehrlichia ruminantium strain Sanka... 59 7e-07
CP001321_2001(CP001321|pid:none) Haemophilus parasuis SH0165, co... 59 7e-07
(P51037) RecName: Full=Citrate synthase, chromosomal; E... 59 7e-07
DQ513396_1(DQ513396|pid:none) Ehrlichia ruminantium strain Seneg... 59 7e-07
DQ513397_1(DQ513397|pid:none) Ehrlichia ruminantium strain Kumm1... 59 7e-07
DQ513395_1(DQ513395|pid:none) Ehrlichia ruminantium strain Pokoa... 59 7e-07
AE017354_1389(AE017354|pid:none) Legionella pneumophila subsp. p... 59 7e-07
EF077650_1(EF077650|pid:none) Israeli tick typhus rickettsia str... 59 7e-07
CP000140_1047(CP000140|pid:none) Parabacteroides distasonis ATCC... 59 7e-07
AE016827_2371(AE016827|pid:none) Mannheimia succiniciproducens M... 59 7e-07
EF177484_1(EF177484|pid:none) Israeli tick typhus rickettsia str... 59 7e-07
(P20902) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 58 1e-06
BX569695_84(BX569695|pid:none) Synechococcus sp. WH8102 complete... 58 1e-06
CP000393_1330(CP000393|pid:none) Trichodesmium erythraeum IMS101... 58 1e-06
AE016822_1303(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 58 1e-06
(P51038) RecName: Full=Citrate synthase, plasmid; EC=2.... 58 1e-06
AF191033_1(AF191033|pid:none) Mycobacterium smegmatis citrate sy... 58 1e-06
CP001638_2430(CP001638|pid:none) Geobacillus sp. WCH70, complete... 58 1e-06
CP000781_4387(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 58 1e-06
CP000362_2989(CP000362|pid:none) Roseobacter denitrificans OCh 1... 58 1e-06
AF120027_1(AF120027|pid:none) Rickettsia sp. DnS28 strain DnS28 ... 58 1e-06
CP001628_1466(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 58 1e-06
CP000097_277(CP000097|pid:none) Synechococcus sp. CC9902, comple... 58 1e-06
CP000975_332(CP000975|pid:none) Methylacidiphilum infernorum V4,... 58 1e-06
CP000738_1135(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 58 1e-06
(Q59732) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 58 1e-06
AJ609645_1(AJ609645|pid:none) Wolbachia pipientis partial gltA g... 46 1e-06
CP001655_2847(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 58 1e-06
AF311966_1(AF311966|pid:none) Ehrlichia sp. EHt224 citrate synth... 58 1e-06
CP000854_4572(CP000854|pid:none) Mycobacterium marinum M, comple... 58 1e-06
AF088222_1(AF088222|pid:none) Lactococcus lactis subsp. lactis c... 58 1e-06
CP000633_1875(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 58 1e-06
CP000825_180(CP000825|pid:none) Prochlorococcus marinus str. MIT... 58 1e-06
AF304145_1(AF304145|pid:none) Ehrlichia sp. Yamaguchi citrate sy... 58 1e-06
CP000031_2111(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 58 1e-06
AF394896_1(AF394896|pid:none) Rickettsia tamurae strain AT-1 cit... 58 1e-06
CP000099_699(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 57 2e-06
CP000449_1391(CP000449|pid:none) Maricaulis maris MCS10, complet... 57 2e-06
(Q10530) RecName: Full=Citrate synthase 1; EC=2.3.3.1; ... 57 2e-06
EU359285_1(EU359285|pid:none) Rickettsia helvetica isolate 20-2 ... 57 2e-06
AM408590_950(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 57 2e-06
CP001191_1583(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 57 2e-06
CP001186_4606(CP001186|pid:none) Bacillus cereus G9842, complete... 57 2e-06
AY157738_1(AY157738|pid:none) Sinorhizobium fredii citrate synth... 57 2e-06
EU359286_1(EU359286|pid:none) Rickettsia helvetica isolate 21-2 ... 57 2e-06
CP001229_1075(CP001229|pid:none) Sulfurihydrogenibium azorense A... 57 2e-06
DQ365879_1(DQ365879|pid:none) Ehrlichia ewingii citrate synthase... 57 2e-06
CP000576_182(CP000576|pid:none) Prochlorococcus marinus str. MIT... 57 2e-06
CP000100_612(CP000100|pid:none) Synechococcus elongatus PCC 7942... 57 2e-06
CP001389_1323(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 57 2e-06
AF304139_1(AF304139|pid:none) Anaplasma marginale South Idaho ci... 57 2e-06
CU458896_933(CU458896|pid:none) Mycobacterium abscessus chromoso... 57 2e-06
CP000133_1891(CP000133|pid:none) Rhizobium etli CFN 42, complete... 57 2e-06
CP001079_821(CP001079|pid:none) Anaplasma marginale str. Florida... 57 2e-06
AP008231_912(AP008231|pid:none) Synechococcus elongatus PCC 6301... 57 2e-06
AE007869_1367(AE007869|pid:none) Agrobacterium tumefaciens str. ... 57 2e-06
AF304143_1(AF304143|pid:none) Ehrlichia canis Oklahoma citrate s... 57 3e-06
DQ092215_1(DQ092215|pid:none) Rickettsia sp. IM32a citrate synth... 57 3e-06
CU234118_3905(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 57 3e-06
CP000111_172(CP000111|pid:none) Prochlorococcus marinus str. MIT... 57 3e-06
BX548174_168(BX548174|pid:none) Prochlorococcus marinus MED4 com... 57 3e-06
AE009441_2530(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 57 3e-06
DQ513393_1(DQ513393|pid:none) Ehrlichia ruminantium strain Blaau... 57 3e-06
CP000108_311(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 57 3e-06
CP001016_1390(CP001016|pid:none) Beijerinckia indica subsp. indi... 57 3e-06
CP000699_3186(CP000699|pid:none) Sphingomonas wittichii RW1, com... 57 3e-06
(P80148) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 57 3e-06
BA000002_1122(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 57 3e-06
CP001399_2667(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 57 3e-06
CP000552_191(CP000552|pid:none) Prochlorococcus marinus str. MIT... 57 3e-06
CP001029_5120(CP001029|pid:none) Methylobacterium populi BJ001, ... 56 4e-06
DQ513391_1(DQ513391|pid:none) Ehrlichia ruminantium strain Mara8... 56 4e-06
EU839565_1(EU839565|pid:none) Mycobacterium lepromatosis citrate... 56 4e-06
CP000494_4229(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 56 4e-06
CP001402_2662(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 56 4e-06
FJ851108_1(FJ851108|pid:none) Uncultured Bartonella sp. clone Pd... 56 4e-06
(Q53554) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 56 4e-06
BA000023_1956(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 56 4e-06
AF304146_1(AF304146|pid:none) Cowdria ruminantium citrate syntha... 56 4e-06
CP001656_2742(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 56 4e-06
CP000319_1622(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 56 4e-06
CP000359_1513(CP000359|pid:none) Deinococcus geothermalis DSM 11... 56 4e-06
AE008384_1527(AE008384|pid:none) Methanosarcina mazei strain Goe... 56 4e-06
CP000436_967(CP000436|pid:none) Haemophilus somnus 129PT, comple... 56 5e-06
CP000947_1400(CP000947|pid:none) Haemophilus somnus 2336, comple... 56 5e-06
AE017355_4278(AE017355|pid:none) Bacillus thuringiensis serovar ... 56 5e-06
AF503167_1(AF503167|pid:none) Candidatus Rickettsia tarasevichia... 56 5e-06
CP000325_213(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 56 5e-06
CP000485_3963(CP000485|pid:none) Bacillus thuringiensis str. Al ... 56 5e-06
FJ269035_1(FJ269035|pid:none) Rickettsia sp. Intervales citrate ... 56 5e-06
AE016879_4470(AE016879|pid:none) Bacillus anthracis str. Ames, c... 56 5e-06
BA000004_3160(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 56 5e-06
BA000045_3012(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 56 5e-06
CP001215_4701(CP001215|pid:none) Bacillus anthracis str. CDC 684... 56 5e-06
DQ168981_1(DQ168981|pid:none) Rickettsia tarasevichiae strain Us... 55 6e-06
CT971583_2292(CT971583|pid:none) Synechococcus WH7803 complete g... 55 6e-06
AI1632(AI1632) citrate synthase chain II homolog citZ [imported]... 55 6e-06
CP000908_4619(CP000908|pid:none) Methylobacterium extorquens PA1... 55 6e-06
CP000454_2789(CP000454|pid:none) Arthrobacter sp. FB24, complete... 55 6e-06
CP000922_504(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 55 6e-06
AE017194_4690(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 55 8e-06
CP001175_983(CP001175|pid:none) Listeria monocytogenes HCC23, co... 55 8e-06
AE017333_2936(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 55 8e-06
AJ564633_1(AJ564633|pid:none) Bartonella schoenbuchensis partial... 55 8e-06
DQ513392_1(DQ513392|pid:none) Ehrlichia ruminantium strain Ball3... 55 8e-06
AJ278186_1(AJ278186|pid:none) Bartonella schoenbuchii partial gl... 55 8e-06
CT573213_108(CT573213|pid:none) Frankia alni str. ACN14A chromos... 55 8e-06
CP000419_1038(CP000419|pid:none) Streptococcus thermophilus LMD-... 55 1e-05
AP009153_571(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 55 1e-05
AF311965_1(AF311965|pid:none) Ehrlichia sp. ERm58 citrate syntha... 55 1e-05
CP000232_1095(CP000232|pid:none) Moorella thermoacetica ATCC 390... 55 1e-05
U59712_1(U59712|pid:none) Rickettsia sp. AB bacterium citrate sy... 55 1e-05
BA000030_5337(BA000030|pid:none) Streptomyces avermitilis MA-468... 55 1e-05
AY515124_1(AY515124|pid:none) Bartonella rattimassiliensis strai... 55 1e-05
CP000023_1169(CP000023|pid:none) Streptococcus thermophilus LMG ... 55 1e-05
FJ666770_1(FJ666770|pid:none) Rickettsia endosymbiont of Aulogym... 46 1e-05
FJ666757_1(FJ666757|pid:none) Rickettsia endosymbiont of Bombyli... 45 1e-05
FJ666759_1(FJ666759|pid:none) Rickettsia endosymbiont of Chrysop... 45 1e-05
AJ621309_1(AJ621309|pid:none) Thermoproteus tenax cis2 gene for ... 51 1e-05
BA000011_241(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 54 1e-05
BX571869_175(BX571869|pid:none) Photorhabdus luminescens subsp. ... 54 1e-05
FJ851103_1(FJ851103|pid:none) Uncultured Bartonella sp. clone Lf... 54 1e-05
AE017283_2213(AE017283|pid:none) Propionibacterium acnes KPA1712... 54 1e-05
FJ851107_1(FJ851107|pid:none) Uncultured Bartonella sp. clone Mm... 54 1e-05
CP000127_2527(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 54 1e-05
AG1270(AG1270) citrate synthase chain II homolog citZ [imported]... 54 1e-05
AB190318_2(AB190318|pid:none) Uncultured bacterium bzo32-1, bzo3... 54 1e-05
AM711867_2196(AM711867|pid:none) Clavibacter michiganensis subsp... 54 1e-05
AP006627_4031(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 54 2e-05
CP001213_1053(CP001213|pid:none) Bifidobacterium animalis subsp.... 54 2e-05
CP000474_2673(CP000474|pid:none) Arthrobacter aurescens TC1, com... 54 2e-05
(P21553) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 54 2e-05
>(Q553V1) RecName: Full=Citrate synthase, mitochondrial;
EC=2.3.3.1; Flags: Precursor;
Length = 460
Score = 399 bits (1026), Expect(3) = 0.0
Identities = 201/201 (100%), Positives = 201/201 (100%)
Frame = +2
Query: 203 MFARLARANYLKNSGRYFSTEPTLKERLVQIIPGKIEQVKQLKTEHGDKIIGTCTVAQAY 382
MFARLARANYLKNSGRYFSTEPTLKERLVQIIPGKIEQVKQLKTEHGDKIIGTCTVAQAY
Sbjct: 1 MFARLARANYLKNSGRYFSTEPTLKERLVQIIPGKIEQVKQLKTEHGDKIIGTCTVAQAY 60
Query: 383 GGMRSVKSLVTETSSLDPEEGIRFRGLTIPECQEKLPKAPGGAEPLPEGILWLLLTGEVP 562
GGMRSVKSLVTETSSLDPEEGIRFRGLTIPECQEKLPKAPGGAEPLPEGILWLLLTGEVP
Sbjct: 61 GGMRSVKSLVTETSSLDPEEGIRFRGLTIPECQEKLPKAPGGAEPLPEGILWLLLTGEVP 120
Query: 563 TESQVKTLSKDLAKRAGLPKHVTSMIKAFPEQMHPMSQLAAAILALQGESKFVKAYNDGV 742
TESQVKTLSKDLAKRAGLPKHVTSMIKAFPEQMHPMSQLAAAILALQGESKFVKAYNDGV
Sbjct: 121 TESQVKTLSKDLAKRAGLPKHVTSMIKAFPEQMHPMSQLAAAILALQGESKFVKAYNDGV 180
Query: 743 KKDKYWESTLEDSLDVIAKLP 805
KKDKYWESTLEDSLDVIAKLP
Sbjct: 181 KKDKYWESTLEDSLDVIAKLP 201
Score = 377 bits (969), Expect(3) = 0.0
Identities = 183/197 (92%), Positives = 184/197 (93%)
Frame = +1
Query: 985 LGAHTTHLVGXXXXXXXXXXXXGMCGLAGPLHGLANQEVLSWTMKLQEKLGNKEVSNEVL 1164
+ AHTTHLVG GMCGLAGPLHGLANQEVLSWTMKLQEKLGNKEVSNEVL
Sbjct: 261 VSAHTTHLVGSALSDSYLSLSAGMCGLAGPLHGLANQEVLSWTMKLQEKLGNKEVSNEVL 320
Query: 1165 SEAIWEGLNAGRVVPGFGHAVLRKTDPRYTCQREFALKHLPQDPLFKLVSQIYEVVPDIL 1344
SEAIWEGLNAGRVVPGFGHAVLRKTDPRYTCQREFALKHLPQDPLFKLVSQIYEVVPDIL
Sbjct: 321 SEAIWEGLNAGRVVPGFGHAVLRKTDPRYTCQREFALKHLPQDPLFKLVSQIYEVVPDIL 380
Query: 1345 TKHGKTKNPYPNVDAHSGCLLQYYGLKEHNFYTVLFGVSRAIGVLSSLVWDRILGHPIER 1524
TKHGKTKNPYPNVDAHSGCLLQYYGLKEHNFYTVLFGVSRAIGVLSSLVWDRILGHPIER
Sbjct: 381 TKHGKTKNPYPNVDAHSGCLLQYYGLKEHNFYTVLFGVSRAIGVLSSLVWDRILGHPIER 440
Query: 1525 PKSVTTEWISSYVNSDQ 1575
PKSVTTEWISSYVNSDQ
Sbjct: 441 PKSVTTEWISSYVNSDQ 457
Score = 130 bits (328), Expect(3) = 0.0
Identities = 61/61 (100%), Positives = 61/61 (100%)
Frame = +3
Query: 804 PEVAALIYQNTYKKSDITHKIDENLDWSANFNRMLGYTSKDFDELMRLYLTIHTDHEGGN 983
PEVAALIYQNTYKKSDITHKIDENLDWSANFNRMLGYTSKDFDELMRLYLTIHTDHEGGN
Sbjct: 201 PEVAALIYQNTYKKSDITHKIDENLDWSANFNRMLGYTSKDFDELMRLYLTIHTDHEGGN 260
Query: 984 V 986
V
Sbjct: 261 V 261
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 2,719,677,105
Number of extensions: 54477250
Number of successful extensions: 138415
Number of sequences better than 10.0: 1251
Number of HSP's gapped: 136673
Number of HSP's successfully gapped: 1817
Length of query: 575
Length of database: 1,061,185,681
Length adjustment: 134
Effective length of query: 441
Effective length of database: 623,213,649
Effective search space: 274837219209
Effective search space used: 274837219209
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
7 |
| VH (FL, L) |
1 |
| VF (FL, S) |
92 |
| AH (FL, L) |
0 |
| AF (FL, S) |
19 |
| SL (DIR, L) |
3 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
14 |
| CH (FL, L) |
2 |
| CF (FL, S) |
9 |
| FCL (DIR, L) |
1 |
| FC (DIR, S) |
1 |
| FC-IC (SUB) |
0 |