Contig-U03781-1
Contig ID Contig-U03781-1
Contig update 2001. 8.29
Contig sequence
>Contig-U03781-1 (Contig-U03781-1Q) /CSM_Contig/Contig-U03781-1Q.Seq.d
ATTTCGCATGGGTATTGGATGAACAAGAGGAAGAACGTGAGCGTGGTGTA
ACTATGGATGNTTGTGTGCGTTACTTTGAAACAGAGCATAGAAGAATCAC
ACTATTGGACGCACCAGGTCACAGAGATTTCATACCAAATATGATCAGTG
GTACAACTCAAGCAGATGTTGCAATATTATTAATTAACGCATCAGAATTT
GAAGCAGGTTTCTCAGCGGAGGGTCAAACTAAAGAACATGCTTTACTCGC
AAAATCATTAGGTATCATGGAATTAATTGTAGCAGTCAATAAAATGGATT
CAATCGAATGGGATCAATCACGTTACGA

Gap no gap
Contig length 328
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 1144788
End point 1145116
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U03781
List of clone(s)

est1=SLA345F,1,329
Translated Amino Acid sequence
FAWVLDEQEEERERGVTMDXCVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILL
INASEFEAGFSAEGQTKEHALLAKSLGIMELIVAVNKMDSIEWDQSRY


Translated Amino Acid sequence (All Frames)
Frame A:
ishgywmnkrknvsvv*lwmxvcvtlkqsieeshywthqvteisyqi*svvqlkqmlqyy
*lthqnlkqvsqrrvklknmlysqnh*vswn*l*qsikwiqsnginhvt


Frame B:
frmgig*trgrt*awcnygxlcall*nra*knhtigrtrsqrfhtkydqwynssrccnii
n*riri*srflsggsn*rtcftrkiiryhgincssq*ngfnrmgsitlr


Frame C:
FAWVLDEQEEERERGVTMDXCVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILL
INASEFEAGFSAEGQTKEHALLAKSLGIMELIVAVNKMDSIEWDQSRY


own update 2004. 6. 9
Homology vs CSM-cDNA
Query= Contig-U03781-1 (Contig-U03781-1Q)
/CSM_Contig/Contig-U03781-1Q.Seq.d
(328 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U03781-1 (Contig-U03781-1Q) /CSM_Contig/Conti... 644 0.0
Contig-U06058-1 (Contig-U06058-1Q) /CSM_Contig/Conti... 40 0.001
Contig-U14238-1 (Contig-U14238-1Q) /CSM_Contig/Conti... 32 0.35
Contig-U11415-1 (Contig-U11415-1Q) /CSM_Contig/Conti... 32 0.35
Contig-U13830-1 (Contig-U13830-1Q) /CSM_Contig/Conti... 30 1.4
Contig-U13187-1 (Contig-U13187-1Q) /CSM_Contig/Conti... 30 1.4
Contig-U13057-1 (Contig-U13057-1Q) /CSM_Contig/Conti... 30 1.4
Contig-U12515-1 (Contig-U12515-1Q) /CSM_Contig/Conti... 30 1.4
Contig-U12196-1 (Contig-U12196-1Q) /CSM_Contig/Conti... 30 1.4
Contig-U11942-1 (Contig-U11942-1Q) /CSM_Contig/Conti... 30 1.4

>Contig-U03781-1 (Contig-U03781-1Q) /CSM_Contig/Contig-U03781-1Q.Seq.d
Length = 328

Score = 644 bits (325), Expect = 0.0
Identities = 328/328 (100%)
Strand = Plus / Plus


Query: 1 atttcgcatgggtattggatgaacaagaggaagaacgtgagcgtggtgtaactatggatg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atttcgcatgggtattggatgaacaagaggaagaacgtgagcgtggtgtaactatggatg 60


Query: 61 nttgtgtgcgttactttgaaacagagcatagaagaatcacactattggacgcaccaggtc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 nttgtgtgcgttactttgaaacagagcatagaagaatcacactattggacgcaccaggtc 120


Query: 121 acagagatttcataccaaatatgatcagtggtacaactcaagcagatgttgcaatattat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 acagagatttcataccaaatatgatcagtggtacaactcaagcagatgttgcaatattat 180


Query: 181 taattaacgcatcagaatttgaagcaggtttctcagcggagggtcaaactaaagaacatg 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 taattaacgcatcagaatttgaagcaggtttctcagcggagggtcaaactaaagaacatg 240


Query: 241 ctttactcgcaaaatcattaggtatcatggaattaattgtagcagtcaataaaatggatt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 ctttactcgcaaaatcattaggtatcatggaattaattgtagcagtcaataaaatggatt 300


Query: 301 caatcgaatgggatcaatcacgttacga 328
||||||||||||||||||||||||||||
Sbjct: 301 caatcgaatgggatcaatcacgttacga 328


>Contig-U06058-1 (Contig-U06058-1Q) /CSM_Contig/Contig-U06058-1Q.Seq.d
Length = 1185

Score = 40.1 bits (20), Expect = 0.001
Identities = 20/20 (100%)
Strand = Plus / Plus


Query: 114 ccaggtcacagagatttcat 133
||||||||||||||||||||
Sbjct: 314 ccaggtcacagagatttcat 333


>Contig-U14238-1 (Contig-U14238-1Q) /CSM_Contig/Contig-U14238-1Q.Seq.d
Length = 1181

Score = 32.2 bits (16), Expect = 0.35
Identities = 16/16 (100%)
Strand = Plus / Plus


Query: 20 tgaacaagaggaagaa 35
||||||||||||||||
Sbjct: 158 tgaacaagaggaagaa 173


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 2907
Number of Sequences: 6905
Number of extensions: 2907
Number of successful extensions: 270
Number of sequences better than 10.0: 69
length of query: 328
length of database: 5,674,871
effective HSP length: 15
effective length of query: 313
effective length of database: 5,571,296
effective search space: 1743815648
effective search space used: 1743815648
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 6. 7
Homology vs DNA
Query= Contig-U03781-1 (Contig-U03781-1Q) /CSM_Contig/Contig-U03781-1Q.Seq.d
(328 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AY185333) Dictyostelium discoideum Hsp70 subfamily B suppre... 644 0.0 1
(AU060111) Dictyostelium discoideum slug cDNA, clone SLA345. 644 0.0 1
(AY185332) Dictyostelium discoideum Hsp70 subfamily B suppre... 200 2e-47 1
(BM163741) EST566264 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM164868) EST567391 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM160331) EST562854 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM160973) EST563496 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM165210) EST567733 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM168802) EST571325 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM167857) EST570380 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM166154) EST568677 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM170634) EST573157 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM170150) EST572673 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM162190) EST564713 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM161425) EST563948 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM159322) EST561845 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM170808) EST573331 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM159859) EST562382 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM160830) EST563353 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM171271) EST573794 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM167165) EST569688 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM160936) EST563459 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(BM170207) EST572730 PyBS Plasmodium yoelii yoelii cDNA clon... 50 1e-06 2
(EU810316) Gymnochlora stellata translation elongation facto... 56 3e-06 2
(EC819378) SME00000865 esmbsro2 Sawyeria marylandensis cDNA,... 48 4e-05 2
(EC819786) SME00005380 esmbsro2 Sawyeria marylandensis cDNA,... 48 4e-05 2
(EC820460) SME00006794 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC820404) SME00002973 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC820814) SME00003409 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC820729) SME00000488 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC821045) SME00005168 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC821151) SME00008591 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC821215) SME00008288 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC821218) SME00009016 esmbsro2 Sawyeria marylandensis cDNA,... 48 5e-05 2
(EC821478) SME00005187 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822155) SME00007754 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC821649) SME00003715 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822278) SME00003972 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822509) SME00007594 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC823015) SME00005626 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822725) SME00002873 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822707) SME00005376 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822771) SME00005656 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC823532) SME00004062 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC822842) SME00010316 esmbsro2 Sawyeria marylandensis cDNA,... 48 6e-05 2
(EC823431) SME00009130 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC823549) SME00010094 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC823505) SME00005401 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824045) SME00002107 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824758) SME00005349 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC823896) SME00006513 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC823940) SME00004190 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825061) SME00006619 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824740) SME00002576 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824160) SME00002492 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824184) SME00007455 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC823706) SME00005504 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824246) SME00009251 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824232) SME00004894 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824229) SME00000843 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824236) SME00006322 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824275) SME00004678 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825317) SME00009348 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824404) SME00005090 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824403) SME00007912 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825414) SME00006096 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824675) SME00010215 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824674) SME00005681 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824724) SME00006770 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825754) SME00010184 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC824865) SME00006921 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825379) SME00003963 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825072) SME00004883 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825138) SME00010288 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825636) SME00009301 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC826002) SME00007764 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825763) SME00003111 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC826172) SME00009767 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825667) SME00003629 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC825492) SME00008353 esmbsro2 Sawyeria marylandensis cDNA,... 48 7e-05 2
(EC826286) SME00005240 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC825704) SME00005880 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC825255) SME00001817 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826420) SME00006950 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC825902) SME00006165 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC825984) SME00001709 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC825999) SME00001155 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826087) SME00009441 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826461) SME00002752 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826538) SME00001270 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826479) SME00004676 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826262) SME00000292 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826575) SME00000379 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826397) SME00006440 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(EC826624) SME00007907 esmbsro2 Sawyeria marylandensis cDNA,... 48 8e-05 2
(ES392632) MUS09-P21.x1d-t SHGC-MUS Mytilus californianus cD... 48 9e-05 2
(AJ392946) Gallus gallus EST clone 13j2r1. 36 1e-04 3
(BU479720) 603842905F1 CSEQRBN22 Gallus gallus cDNA clone Ch... 36 1e-04 3
(BU280816) 603863949F1 CSEQCHN54 Gallus gallus cDNA clone Ch... 36 2e-04 3
(BU423380) 603961014F1 CSEQRBN09 Gallus gallus cDNA clone Ch... 36 2e-04 3
(CO642810) USDA-FP_111549 Adult Glassy-winged Sharpshooter H... 58 2e-04 1
(AL403513) T7 end of clone AT0AA009B07 of library AT0AA from... 40 3e-04 2
(CF469964) P7-B7 Plasmodium yoelli 17X axenic hepatic stages... 42 4e-04 2
(AF402027) Saccharomyces kunashirensis strain NRRL Y-27209 t... 40 4e-04 2
(AF402025) Saccharomyces spencerorum strain NRRL Y-17920 tra... 40 4e-04 2
(AF402018) Saccharomyces unisporus strain NRRL Y-1556 transl... 40 4e-04 2
(AF402017) Saccharomyces servazzii strain NRRL Y-12661 trans... 40 4e-04 2
(AF056105) Spathidium sp. translation elongation factor 1-al... 30 8e-04 3
(BM169415) EST571938 PyBS Plasmodium yoelii yoelii cDNA clon... 50 9e-04 2
(AY804432) Parides agavus isolate 2 elongation factor 1 alph... 38 0.001 3
(EU880818) Donacia tomentosa voucher Donaciinae217 elongatio... 44 0.001 3
(EU880819) Donacia tomentosa voucher Donaciinae216 elongatio... 44 0.001 3
(AY804431) Parides agavus isolate 1 elongation factor 1 alph... 38 0.002 3
(EC824133) SME00004248 esmbsro2 Sawyeria marylandensis cDNA,... 34 0.002 3
(FE230893) CAPG10045.fwd CAPG Naegleria gruberi amoeba stage... 40 0.003 2
(AY131130) Sitophilus granarius elongation factor 1-alpha ge... 38 0.003 3
(EG353927) SAAH-aaa72e05.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EE673294) SAAH-aab83g02.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EE670224) SAAH-aac45g01.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(Z83668) Rhyssalus sp. gene encoding elongation factor 1 alp... 38 0.003 3
(EG418097) SAAH-aab68f07.b1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EE671897) SAAH-aab68f07.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EC617882) SAAH-aaa61g11.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EE284186) SAAH-aab40d01.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EC615147) SAAH-aaa50h11.g1 Agen 0058 Schmidtea mediterranea... 44 0.003 2
(EG353482) SAAH-aaa34h01.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE668729) SAAH-aac29c09.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE669626) SAAH-aac39f03.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE673749) SAAH-aab88g02.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EG350807) SAAH-aad14e01.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(DN316422) PL06023B1H07 cDNA from juvenile hermaphodites Sch... 44 0.004 2
(EE282140) SAAH-aab01b09.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE670724) SAAH-aac50g04.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE669579) SAAH-aab47c04.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(EE668040) SAAH-aac01b06.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(GE752186) MUS14-P18.x1d-t SHGC-MUS Mytilus californianus cD... 42 0.004 2
(EC384950) SAAH-aaa01a03.g1 Agen 0058 Schmidtea mediterranea... 44 0.004 2
(AF186678) Hylocurus femineus elongation factor 1 alpha (ef-... 36 0.004 3
(CN754510) ID0AAA13AH07RM1 ApMS Acyrthosiphon pisum cDNA clo... 48 0.004 2
(DN310053) PL06006A2F03 cDNA from juvenile hermaphodites Sch... 44 0.004 2
(DN310623) PL06007B2G11 cDNA from juvenile hermaphodites Sch... 44 0.004 2
(DN315278) PL06020B1D11 cDNA from juvenile hermaphodites Sch... 44 0.005 2
(BP191440) Dugesia japonica cDNA, clone: 07207_HH, expressed... 34 0.005 3
(BP190708) Dugesia japonica cDNA, clone: 05420_HH, expressed... 34 0.005 3
(BP190705) Dugesia japonica cDNA, clone: 05416_HH, expressed... 34 0.005 3
(BP190514) Dugesia japonica cDNA, clone: 04856_HH, expressed... 34 0.005 3
(BP190505) Dugesia japonica cDNA, clone: 04846_HH, expressed... 34 0.005 3
(BP190277) Dugesia japonica cDNA, clone: 04583_HH, expressed... 34 0.005 3
(BP189907) Dugesia japonica cDNA, clone: 02848_HH, expressed... 34 0.005 3
(BP189492) Dugesia japonica cDNA, clone: 06536_HH, expressed... 34 0.005 3
(BP189447) Dugesia japonica cDNA, clone: 06483_HH, expressed... 34 0.005 3
(BP189257) Dugesia japonica cDNA, clone: 06255_HH, expressed... 34 0.005 3
(BP189085) Dugesia japonica cDNA, clone: 06024_HH, expressed... 34 0.005 3
(BP188692) Dugesia japonica cDNA, clone: 05132_HH, expressed... 34 0.005 3
(BP188380) Dugesia japonica cDNA, clone: 02761_HH, expressed... 34 0.005 3
(BP188049) Dugesia japonica cDNA, clone: 01922_HH, expressed... 34 0.005 3
(BP188044) Dugesia japonica cDNA, clone: 02075_HH, expressed... 34 0.005 3
(BP187444) Dugesia japonica cDNA, clone: 00416_HN, expressed... 34 0.005 3
(BP187258) Dugesia japonica cDNA, clone: 00584_HN, expressed... 34 0.005 3
(BP186777) Dugesia japonica cDNA, clone: 01110_HH, expressed... 34 0.005 3
(BP186776) Dugesia japonica cDNA, clone: 01113_HH, expressed... 34 0.005 3
(BP186287) Dugesia japonica cDNA, clone: 01846_HH, expressed... 34 0.005 3
(BP186128) Dugesia japonica cDNA, clone: 02110_HH, expressed... 34 0.005 3
(BP185298) Dugesia japonica cDNA, clone: 04064_HH, expressed... 34 0.005 3
(CX244634) B12 cDNA-AFLP clones from Aegilops tauschii Aegil... 44 0.006 2
(AY804428) Euryades corethrus elongation factor 1 alpha (EF-... 36 0.006 3
(EV498361) sg140D05 Cotton Lambda Zap Express Library Gossyp... 34 0.008 3
(EU880724) Plateumaris rustica voucher Donaciinae128 elongat... 44 0.009 2
(BI772897) kp97d07.y1 TBN95TM-SSR Strongyloides stercoralis ... 40 0.009 2
(DR389313) USDA-FP_149133 Adult Alate Aphis gossypii (WHAGA)... 44 0.010 2
(DR389872) USDA-FP_149692 Adult Alate Aphis gossypii (WHAGA)... 44 0.011 2
(DR395571) USDA-FP_155506 Adult Alate Aphis gossypii (WHAGA)... 44 0.011 2
(DR393956) USDA-FP_153890 Adult Alate Aphis gossypii (WHAGA)... 44 0.012 2
(EU880723) Plateumaris rustica voucher Donaciinae124 elongat... 44 0.012 2
(DR390777) USDA-FP_150709 Adult Alate Aphis gossypii (WHAGA)... 44 0.012 2
(EU880727) Plateumaris rustica voucher Donaciinae126 elongat... 44 0.012 2
(DR392095) USDA-FP_152027 Adult Alate Aphis gossypii (WHAGA)... 44 0.012 2
(DR389534) USDA-FP_149354 Adult Alate Aphis gossypii (WHAGA)... 44 0.012 2
(BI772981) kq17c04.y1 TBN95TM-SSR Strongyloides stercoralis ... 40 0.012 2
(DR395123) USDA-FP_155058 Adult Alate Aphis gossypii (WHAGA)... 44 0.013 2
(DR393305) USDA-FP_153237 Adult Alate Aphis gossypii (WHAGA)... 44 0.013 2
(DR395387) USDA-FP_155322 Adult Alate Aphis gossypii (WHAGA)... 44 0.013 2
(DR391735) USDA-FP_151667 Adult Alate Aphis gossypii (WHAGA)... 44 0.013 2
(DR390587) USDA-FP_150519 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR394324) USDA-FP_154258 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(AF364346) Aplomya theclarum elongation factor 1 alpha gene,... 38 0.014 3
(AF364385) Orasturmia vallicola isolate 1 elongation factor ... 34 0.014 3
(DR391399) USDA-FP_151331 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR396604) USDA-FP_156543 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR391503) USDA-FP_151435 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR395656) USDA-FP_155591 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR393682) USDA-FP_153615 Adult Alate Aphis gossypii (WHAGA)... 44 0.014 2
(DR390517) USDA-FP_150449 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(DR393084) USDA-FP_153016 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(DR390314) USDA-FP_150134 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(FM963704) Glossina morsitans morsitans EST, clone GMsg44h07... 44 0.015 2
(DR392099) USDA-FP_152031 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(DR394946) USDA-FP_154881 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(DR396413) USDA-FP_156351 Adult Alate Aphis gossypii (WHAGA)... 44 0.015 2
(DR395029) USDA-FP_154964 Adult Alate Aphis gossypii (WHAGA)... 44 0.016 2
(DR396075) USDA-FP_156010 Adult Alate Aphis gossypii (WHAGA)... 44 0.016 2
(DR397124) USDA-FP_157063 Adult Alate Aphis gossypii (WHAGA)... 44 0.016 2
(DR392917) USDA-FP_152849 Adult Alate Aphis gossypii (WHAGA)... 44 0.016 2
(BP188085) Dugesia japonica cDNA, clone: 01413_HH, expressed... 32 0.017 3
(BP185585) Dugesia japonica cDNA, clone: 03473_HH, expressed... 32 0.017 3
(DR392402) USDA-FP_152334 Adult Alate Aphis gossypii (WHAGA)... 44 0.017 2
(AF375272) Pityophthorus sp. SCH07 elongation factor-1 alpha... 36 0.017 3
(DR394245) USDA-FP_154179 Adult Alate Aphis gossypii (WHAGA)... 44 0.017 2
(DR396089) USDA-FP_156025 Adult Alate Aphis gossypii (WHAGA)... 44 0.018 2
(AM039499) Hanseniaspora osmophila partial tef1 gene for tra... 44 0.019 2
(BM401883) PH061F Snake Bothrops insularis library IL2 Bothr... 32 0.020 3
(AF435389) Lasioglossum punctatum elongation factor-1 alpha ... 30 0.021 4
(AF402072) Hanseniaspora osmophila strain NRRL Y-1613 transl... 44 0.023 2
(EU275700) Actinote zikani voucher ac83 elongation factor-1 ... 38 0.025 2
(EU191899) Tomicus piniperda elongation factor 1 alpha (EF-1... 38 0.030 3
(AF308399) Sueus niisimai elongation factor 1 alpha (ef-1a) ... 28 0.039 3
(AY185331) Dictyostelium discoideum eukaryotic release facto... 38 0.040 2
(BJ390243) Dictyostelium discoideum cDNA clone:dds21n17, 5' ... 38 0.042 2
(DQ538683) Glypta fumiferanae elongation factor 1 alpha (EF1... 36 0.043 3
(AY040315) Tomicus minor elongation factor 1 alpha (ef-1a) g... 38 0.045 3
(AJ562756) Cryptosporidium parvum GSS, PAC clone pica_0011_b... 40 0.047 2
(AQ450437) 500011G04.x2 CpIOWAM13mp18gDNA1 Cryptosporidium p... 40 0.047 2
(AF364350) Carcelia reclinata elongation factor 1 alpha gene... 34 0.050 3
(AY040314) Tomicus piniperda elongation factor 1 alpha (ef-1... 38 0.052 3
(EU152837) Listrophoroides aethiopicus voucher UMMZ BMOC 03-... 50 0.052 1
(BM167415) EST569938 PyBS Plasmodium yoelii yoelii cDNA clon... 50 0.052 1
(BM163463) EST565986 PyBS Plasmodium yoelii yoelii cDNA clon... 50 0.052 1
(BM160903) EST563426 PyBS Plasmodium yoelii yoelii cDNA clon... 50 0.052 1
(BM160384) EST562907 PyBS Plasmodium yoelii yoelii cDNA clon... 50 0.052 1
(GH601733) G1297P539RA23.T0 C. parvum KSU-1 normalized sporo... 40 0.054 2
(GH597490) G1297P532RK1.T0 C. parvum KSU-1 normalized sporoz... 40 0.059 2
(GH597269) G1297P532RK2.T0 C. parvum KSU-1 normalized sporoz... 40 0.059 2
(GH585623) G1297P54RC16.T0 C. parvum KSU-1 normalized sporoz... 40 0.059 2
(GH601698) G1297P539FF7.T0 C. parvum KSU-1 normalized sporoz... 40 0.059 2
(GH590862) G1297P518FO4.T0 C. parvum KSU-1 normalized sporoz... 40 0.059 2
(GH603221) G1297P549RA23.T0 C. parvum KSU-1 normalized sporo... 40 0.059 2
(GH587513) G1297P514FM22.T0 C. parvum KSU-1 normalized sporo... 40 0.059 2
(GH597278) G1297P532RI9.T0 C. parvum KSU-1 normalized sporoz... 40 0.060 2
(GH590310) G1297P517RL18.T0 C. parvum KSU-1 normalized sporo... 40 0.060 2
(GH585701) G1297P54FC5.T0 C. parvum KSU-1 normalized sporozo... 40 0.060 2
(GH588467) G1297P512FJ17.T0 C. parvum KSU-1 normalized sporo... 40 0.060 2
(BP189417) Dugesia japonica cDNA, clone: 06449_HH, expressed... 30 0.060 3
(BP189095) Dugesia japonica cDNA, clone: 06037_HH, expressed... 30 0.060 3
(BP186356) Dugesia japonica cDNA, clone: 01750_HH, expressed... 30 0.060 3
(GH596751) G1297P531RF16.T0 C. parvum KSU-1 normalized sporo... 40 0.061 2
(GH584171) G1297P52RD6.T0 C. parvum KSU-1 normalized sporozo... 40 0.061 2
(GH608651) G1297P560RL2.T0 C. parvum KSU-1 normalized sporoz... 40 0.061 2
(GH585181) G1297P53RJ1.T0 C. parvum KSU-1 normalized sporozo... 40 0.061 2
(GH596280) G1297P531RF20.T0 C. parvum KSU-1 normalized sporo... 40 0.061 2
(GH592511) G1297P521RI6.T0 C. parvum KSU-1 normalized sporoz... 40 0.061 2
(GH587461) G1297P514RO7.T0 C. parvum KSU-1 normalized sporoz... 40 0.062 2
(GH610660) G1297P565RG21.T0 C. parvum KSU-1 normalized sporo... 40 0.062 2
(GH591543) G1297P522RF24.T0 C. parvum KSU-1 normalized sporo... 40 0.062 2
(GH584599) G1297P53RC21.T0 C. parvum KSU-1 normalized sporoz... 40 0.062 2
(GH592667) G1297P521RJ6.T0 C. parvum KSU-1 normalized sporoz... 40 0.062 2
(GH600072) G1297P536RB5.T0 C. parvum KSU-1 normalized sporoz... 40 0.062 2
(GH594254) G1297P528RG1.T0 C. parvum KSU-1 normalized sporoz... 40 0.062 2
(GH603382) G1297P549FJ18.T0 C. parvum KSU-1 normalized sporo... 40 0.062 2
(GH601658) G1297P539RC15.T0 C. parvum KSU-1 normalized sporo... 40 0.062 2
(GH606164) G1297P557RD17.T0 C. parvum KSU-1 normalized sporo... 40 0.062 2
(GH598731) G1297P535RA5.T0 C. parvum KSU-1 normalized sporoz... 40 0.063 2
(GH592503) G1297P521RN1.T0 C. parvum KSU-1 normalized sporoz... 40 0.063 2
(GH598532) G1297P535RD2.T0 C. parvum KSU-1 normalized sporoz... 40 0.063 2
(GH595575) G1297P530RG17.T0 C. parvum KSU-1 normalized sporo... 40 0.063 2
(GH588233) G1297P516FI23.T0 C. parvum KSU-1 normalized sporo... 40 0.063 2
(GH610795) G1297P565RJ11.T0 C. parvum KSU-1 normalized sporo... 40 0.063 2
(GH610086) G1297P564FJ1.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH606568) G1297P557RM23.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH603921) G1297P546RG16.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH596608) G1297P531RJ20.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH610363) G1297P565RE11.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH605246) G1297P554RC19.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH586070) G1297P54RM14.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH597083) G1297P531RO12.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH602107) G1297P539RP14.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH606078) G1297P557FC7.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH593812) G1297P529RA7.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH610542) G1297P565RC7.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH593259) G1297P525RD13.T0 C. parvum KSU-1 normalized sporo... 40 0.064 2
(GH584946) G1297P53RJ18.T0 C. parvum KSU-1 normalized sporoz... 40 0.064 2
(GH593879) G1297P529RG22.T0 C. parvum KSU-1 normalized sporo... 40 0.065 2
(GH592163) G1297P522RM16.T0 C. parvum KSU-1 normalized sporo... 40 0.065 2
(GH589256) G1297P59RF3.T0 C. parvum KSU-1 normalized sporozo... 40 0.065 2
(GH611279) G1297P566RF17.T0 C. parvum KSU-1 normalized sporo... 40 0.065 2
(GH610057) G1297P564RJ5.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH604491) G1297P552RD4.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH592713) G1297P521RP13.T0 C. parvum KSU-1 normalized sporo... 40 0.065 2
(GH606103) G1297P557RB1.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH584814) G1297P53RI4.T0 C. parvum KSU-1 normalized sporozo... 40 0.065 2
(GH595320) G1297P530RC8.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH585172) G1297P53RN8.T0 C. parvum KSU-1 normalized sporozo... 40 0.065 2
(GH583609) G1297P51RL15.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH606282) G1297P557RP1.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH586659) G1297P511RG16.T0 C. parvum KSU-1 normalized sporo... 40 0.065 2
(GH586137) G1297P54RM16.T0 C. parvum KSU-1 normalized sporoz... 40 0.065 2
(GH593398) G1297P528RD22.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH594731) G1297P529RK20.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH592918) G1297P525RG13.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH607432) G1297P558RD21.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH605527) G1297P554RN20.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH606083) G1297P554RP20.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH604745) G1297P552RE10.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH604876) G1297P552RN8.T0 C. parvum KSU-1 normalized sporoz... 40 0.066 2
(GH592943) G1297P525RF8.T0 C. parvum KSU-1 normalized sporoz... 40 0.066 2
(GH590939) G1297P518RM16.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH600578) G1297P536RL9.T0 C. parvum KSU-1 normalized sporoz... 40 0.066 2
(GH590830) G1297P518RM9.T0 C. parvum KSU-1 normalized sporoz... 40 0.066 2
(EU748858) Naupactus dissimulator isolate ND01A elongation f... 40 0.066 2
(GH609611) G1297P564RD16.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH598171) G1297P534RF2.T0 C. parvum KSU-1 normalized sporoz... 40 0.066 2
(GH593282) G1297P528RB13.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH611798) G1297P566RO21.T0 C. parvum KSU-1 normalized sporo... 40 0.066 2
(GH604696) G1297P552FF17.T0 C. parvum KSU-1 normalized sporo... 40 0.067 2
(GH597219) G1297P532FA12.T0 C. parvum KSU-1 normalized sporo... 40 0.067 2
(GH589097) G1297P59RE1.T0 C. parvum KSU-1 normalized sporozo... 40 0.067 2
(GH603881) G1297P546RL10.T0 C. parvum KSU-1 normalized sporo... 40 0.067 2
(GH588508) G1297P512RD17.T0 C. parvum KSU-1 normalized sporo... 40 0.067 2
(GH588009) G1297P512RA4.T0 C. parvum KSU-1 normalized sporoz... 40 0.067 2
(GH600058) G1297P536RD4.T0 C. parvum KSU-1 normalized sporoz... 40 0.067 2
(GH584127) G1297P52RH23.T0 C. parvum KSU-1 normalized sporoz... 40 0.067 2
(AF364383) Mystacella frioensis elongation factor 1 alpha ge... 38 0.067 2
(GH603551) G1297P549RO9.T0 C. parvum KSU-1 normalized sporoz... 40 0.067 2
(GH584039) G1297P52RF20.T0 C. parvum KSU-1 normalized sporoz... 40 0.067 2
(GH596055) G1297P530RP18.T0 C. parvum KSU-1 normalized sporo... 40 0.068 2
(GH603871) G1297P546RO10.T0 C. parvum KSU-1 normalized sporo... 40 0.068 2
(GH587938) G1297P516RP11.T0 C. parvum KSU-1 normalized sporo... 40 0.068 2
(DW021585) PMAD-aae90i07.g1 Lamprey_WGS_pCMV-sport6 Petromyz... 40 0.069 2
(GH587298) G1297P516RB19.T0 C. parvum KSU-1 normalized sporo... 40 0.069 2
(GH589262) G1297P59RF2.T0 C. parvum KSU-1 normalized sporozo... 40 0.069 2
(AF364375) Lespesia datanarum elongation factor 1 alpha gene... 46 0.070 2
(AF364347) Austrophorocera sp. JOS-2001 elongation factor 1 ... 46 0.070 2
(AX110132) Sequence 865 from Patent WO0123604. 40 0.081 2
(AF402048) Kluyveromyces yarrowii strain NRRL Y-17763 transl... 40 0.086 2
(AF402021) Saccharomyces martiniae strain NRRL Y-409 transla... 40 0.086 2
(AF402020) Saccharomyces transvaalensis strain NRRL Y-17245 ... 40 0.086 2
(EU275696) Actinote thalia anteas voucher ac13 elongation fa... 38 0.087 3
(EU275697) Actinote thalia anteas voucher ac14 elongation fa... 38 0.089 3
(EU275656) Actinote brylla voucher ac4 elongation factor-1 a... 36 0.094 2
(BQ622716) CC_Contig12 Conidiobolus cornatus ARSEF 512 Conid... 36 0.097 2
(DQ012543) Anacharis sp. 1 MB274 elongation factor 1-alpha (... 36 0.11 2
(DY675726) STRCS09JX cold-stressed Fragaria vesca seedlings ... 32 0.11 3
(EU106996) Ichneutes bicolor elongation factor 1 alpha gene,... 40 0.12 2
(EX686097) JS7C191JG Salt and heat stressed Fragaria vesca (... 32 0.12 3
(U71180) Crytposporidium parvum elongation factor-1 alpha mR... 40 0.14 2
(U69697) Cryptosporidium parvum elongation factor 1-alpha (E... 40 0.14 2
(EU880768) Donacia porosicollis voucher Donaciinae173 elonga... 44 0.14 2
(EU880770) Donacia distincta voucher Donaciinae165 elongatio... 44 0.17 2
(EU880731) Plateumaris shoemakeri voucher Donaciinae189 elon... 44 0.17 2
(EU880760) Donacia fulgens voucher Donaciinae190 elongation ... 44 0.17 2
(EY188464) LLAE0092C Spider Loxosceles laeta cDNA library Lo... 40 0.17 2
(EU880726) Plateumaris rustica voucher Donaciinae125 elongat... 40 0.17 2
(AY500949) Aphanarthrum affine voucher A58affF elongation fa... 36 0.18 3
(AY500938) Aphanarthrum affine voucher A44affGC elongation f... 36 0.18 3
(AY500931) Aphanarthrum affine voucher A35affMo elongation f... 36 0.18 3
(AY500929) Aphanarthrum affine voucher A33affMo elongation f... 36 0.18 3
(AY500921) Aphanarthrum affine voucher A24affL elongation fa... 36 0.18 3
(AF364370) Hyphantrophaga virilis elongation factor 1 alpha ... 34 0.18 3
(AF259886) Leptoxyleborus cincinnatus elongation factor 1 al... 36 0.18 3
(AF308410) Xylechinosomus valdivianus elongation factor 1 al... 32 0.18 3
(DY668324) STRAW38JX cold-stressed Fragaria vesca seedlings ... 32 0.19 3
(BF298898) 064PbF08 Pb cDNA #20, Charles Yowell and Jane Car... 38 0.19 2
(EU152836) Listrophoroides cricetomys voucher UMMZ BMOC 03-0... 48 0.21 1
(EU152835) Listrophoroides uranomys voucher UMMZ BMOC 03-090... 48 0.21 1
(AC145261) Zea mays clone ZMMBBc0001A01, *** SEQUENCING IN P... 48 0.21 1
(AC194345) Zea mays chromosome 4 clone CH201-1A1; ZMMBBc0001... 48 0.21 1
(AC185446) Zea mays chromosome unknown clone CH201-346O21; Z... 48 0.21 1
(EC820082) SME00006744 esmbsro2 Sawyeria marylandensis cDNA,... 48 0.21 1
(EC820043) SME00007389 esmbsro2 Sawyeria marylandensis cDNA,... 48 0.21 1
(EC819514) SME00006117 esmbsro2 Sawyeria marylandensis cDNA,... 48 0.21 1
(BB979881) Plasmodium berghei str. ANKA cDNA clone: OK010004... 48 0.21 1
(EY341904) CAWZ11420.fwd CAWZ Helobdella robusta Primary Lat... 48 0.21 1
(EU880738) Plateumaris flavipes voucher Donaciinae178 elonga... 44 0.22 2
(DV560838) EST04328 venom gland cDNA library Deinagkistrodon... 30 0.22 3
(EU880746) Plateumaris frosti voucher Donaciinae180 elongati... 44 0.24 2
(EU880735) Plateumaris fulvipes voucher Donaciinae183 elonga... 44 0.25 2
(EU880734) Plateumaris fulvipes voucher Donaciinae182 elonga... 44 0.25 2
(EU880743) Plateumaris sericea voucher Donaciinae156 elongat... 44 0.25 2
(EU880737) Plateumaris pusilla voucher Donaciinae186 elongat... 44 0.25 2
(EU880739) Plateumaris flavipes voucher Donaciinae179 elonga... 44 0.25 2
(DV559538) EST03028 venom gland cDNA library Deinagkistrodon... 30 0.26 3
(EW967780) LS_13_J15_T7 Headlice composite library with all ... 38 0.27 2
(EU880777) Donacia cinerea voucher Donaciinae104 elongation ... 44 0.28 2
(EU880781) Donacia vulgaris voucher Donaciinae106 elongation... 44 0.28 2
(EU880773) Donacia thalassina voucher Donaciinae130 elongati... 44 0.29 2
(EU880783) Donacia simplex voucher Donaciinae119 elongation ... 44 0.29 2
(AF375266) Platypus compertus elongation factor 1-alpha (ef1... 32 0.30 3
(EU880772) Donacia thalassina voucher Donaciinae103 elongati... 44 0.30 2
(EU880786) Donacia sparganii voucher Donaciinae160 elongatio... 44 0.30 2
(EU880782) Donacia vulgaris voucher Donaciinae108 elongation... 44 0.31 2
(EU880787) Donacia cazieri voucher Donaciinae191 elongation ... 44 0.31 2
(EU880785) Donacia sparganii voucher Donaciinae159 elongatio... 44 0.31 2
(EU880771) Donacia distincta voucher Donaciinae166 elongatio... 44 0.31 2
(EU880784) Donacia simplex voucher Donaciinae144 elongation ... 44 0.31 2
(EU880750) Donacia bicolor voucher Donaciinae149 elongation ... 44 0.31 2
(EU880749) Donacia bicolor voucher Donaciinae150 elongation ... 44 0.31 2
(EU880775) Donacia impressa voucher Donaciinae154 elongation... 44 0.31 2
(EU880752) Donacia marginata voucher Donaciinae136 elongatio... 44 0.31 2
(DV561140) EST04630 venom gland cDNA library Deinagkistrodon... 30 0.32 3
(AF373943) Saturnia galbina elongation factor-1 alpha gene, ... 32 0.32 3
(EU275684) Actinote pellenea pellenea voucher ac74 elongatio... 38 0.32 2
(EU275683) Actinote pellenea pellenea voucher ac37 elongatio... 38 0.34 2
(EU275677) Actinote pellenea epiphaea voucher ac47 elongatio... 38 0.34 2
(EU275658) Actinote carycina voucher ac79 elongation factor-... 38 0.34 2
(EU275682) Actinote pellenea pellenea voucher ac5 elongation... 38 0.35 2
(EU275676) Actinote pellenea calymma voucher ac69 elongation... 38 0.35 2
(EU275687) Actinote pyrrha crucis voucher ac73 elongation fa... 38 0.35 2
(EU275686) Actinote pyrrha crucis voucher ac72 elongation fa... 38 0.35 2
(EU275681) Actinote pellenea mucia voucher ac75 elongation f... 38 0.35 2
(EU275680) Actinote pellenea hyalina voucher ac40 elongation... 38 0.35 2
(EU275678) Actinote pellenea epiphaea voucher ac71 elongatio... 38 0.35 2
(EU275659) Actinote carycina voucher ac88 elongation factor-... 38 0.35 2
(GH601273) G1297P538RO12.T0 C. parvum KSU-1 normalized sporo... 36 0.36 2
(AF186677) Micracis carinulatus elongation factor 1 alpha (e... 44 0.36 2
(CD452284) USDA-FP_104711 Adult Alate Brown Citrus Aphid Tox... 38 0.39 2
(Z83658) P.mindariphagum gene encoding elongation factor 1 a... 36 0.40 2
(EV243499) kn-469-01_e08t7 Pythium oligandrum vegetative myc... 36 0.40 2
(Z83657) P.dorsale gene encoding elongation factor 1 alpha, ... 36 0.42 2
(AM053855) Eudiplodinium maggii EST, clone Em04_G08. 38 0.54 2
(AJ549225) Trichoplax adhaerens mRNA for elongation factor 1... 32 0.57 2
(ES808150) UFL_192_20 Cotton fiber 0-10 day post anthesis Go... 34 0.57 2
(ES819332) UFL_350_10 Cotton fiber 0-10 day post anthesis Go... 34 0.57 2
(ES817503) UFL_279_28 Cotton fiber 0-10 day post anthesis Go... 34 0.57 2
(ES824843) UFL_378_87 Cotton fiber 0-10 day post anthesis Go... 34 0.58 2
(CB909948) USDA-FP_101691 Adult Alate Brown Citrus Aphid Tox... 38 0.58 2
(AF503124) Chelipoda sp. NCSU-95051120 elongation factor-1 a... 36 0.58 2
(ES815551) UFL_315_63 Cotton fiber 0-10 day post anthesis Go... 34 0.58 2
(DW479397) GH_RMIRS_019_E08_R Cotton Normalized Library rand... 34 0.58 2
(CO130146) GR__Eb31M01.r GR__Eb Gossypium raimondii cDNA clo... 34 0.58 2
(DW479396) GH_RMIRS_019_E08_056_F Cotton Normalized Library ... 34 0.58 2
(CO111759) GR__Eb0048A08.r GR__Eb Gossypium raimondii cDNA c... 34 0.58 2
(CU615232) Theobroma cacao, mRNA sequence (KZ0AAN2YH02FM1). 34 0.59 2
(DR453460) CM013E01 Cotton Lambda Zap Express Library Gossyp... 34 0.59 2
(CU549718) Theobroma cacao, mRNA sequence (KZ0AAS8YB16FM1). 34 0.59 2
(BQ407314) GA__Ed0105B11f Gossypium arboreum 7-10 dpa fiber ... 34 0.59 2
(EV491887) 219H10 Cotton Lambda Zap Express Library Gossypiu... 34 0.59 2
(EV491637) 214H04 Cotton Lambda Zap Express Library Gossypiu... 34 0.59 2
(EV497236) sg111F03 Cotton Lambda Zap Express Library Gossyp... 34 0.59 2
(EV497189) sg110E10 Cotton Lambda Zap Express Library Gossyp... 34 0.59 2
(ES794425) UFL_543_67 Cotton fiber 0-10 day post anthesis Go... 34 0.60 2
(AM053856) Eudiplodinium maggii EST, clone Em07_D04. 38 0.61 2
(AY377120) Liparthrum semidegener isolate sem-Madeira elonga... 30 0.62 3
(EU880788) Donacia impressa voucher Donaciinae225 elongation... 42 0.63 2
(AM053857) Eudiplodinium maggii EST, clone Em04_C06. 38 0.64 2
(CV869729) PDUts1070F09 Porcine testis cDNA library I Sus sc... 36 0.65 2
(BI773070) kq36g11.y1 TBN95TM-SSR Strongyloides stercoralis ... 40 0.65 2
(AM053854) Eudiplodinium maggii EST, clone Em03_H04. 38 0.67 2
(EU151680) Nemoria albaria voucher EG03B851 elongation facto... 36 0.72 3
(EU151679) Nemoria viridicaria voucher EG03B856 elongation f... 36 0.75 3
(EU151678) Nemoria arizonaria voucher EG03B815 elongation fa... 36 0.75 3
(EE601927) BT-TYLCV-057-1-F4-T3_F04 Whitefly Bemisia tabaci ... 40 0.81 2
(EU152759) Neottialges vitzthumi voucher UMMZ BMOC 05-1003-0... 46 0.81 1
(EF419313) Myzus persicae isolate Nanjing population elongat... 46 0.81 1
(DQ005158) Nasonovia ribis-nigri elongation factor 1 alpha (... 46 0.81 1
(DQ005153) Macrosiphum aetheocornum elongation factor 1 alph... 46 0.81 1
(AY219736) Macrosiphum rosae elongation factor 1 alpha gene,... 46 0.81 1
(AF163870) Cinara glabra elongation factor 1 alpha gene, par... 46 0.81 1
(DW350076) PU1_plate23_K09 PU1 Prunus persica cDNA clone PU1... 46 0.81 1
(AT000389) Malus x domestica peel cDNA, clone: ap166. 46 0.81 1
(AM290613) Prunus persica EST, clone Skin70G10. 46 0.81 1
(AM054619) Isotricha prostoma EST, clone Ip05_F01. 46 0.81 1
(AM054442) Isotricha prostoma EST, clone Ip07_B09. 46 0.81 1
(AM054441) Isotricha prostoma EST, clone Ip04_B09. 46 0.81 1
(CO069028) Mdfw2061l21.y1 Mdfw Malus x domestica cDNA clone ... 46 0.81 1
(CN943769) 010927AVBC080047PG (AVBC) Royal Gala young shoot ... 46 0.81 1
(CN941362) 010917AVBC024080PG (AVBC) Royal Gala young shoot ... 46 0.81 1
(CN931402) 000427AFBC005542HT (AFBC) Royal Gala pre-opened f... 46 0.81 1
(CN930110) 000322AFBC002136HT (AFBC) Royal Gala pre-opened f... 46 0.81 1
(CN930063) 000322AFBC002067HT (AFBC) Royal Gala pre-opened f... 46 0.81 1
(CN926517) 000501AEPA001838HT (AEPA) Pinkie expanding leaf M... 46 0.81 1
(CN879842) 010419AASA004352HT (AASA) Royal Gala 10 DAFB frui... 46 0.81 1
(CN879580) 010419AASA004893HT (AASA) Royal Gala 10 DAFB frui... 46 0.81 1
(CN879260) 010420AASA006570HT (AASA) Royal Gala 10 DAFB frui... 46 0.81 1
(CN865929) 000824AALB003048HT (AALB) Royal Gala 150 DAFB fru... 46 0.81 1
(CN865810) 000824AALB002808HT (AALB) Royal Gala 150 DAFB fru... 46 0.81 1
(BU042633) PP_LEa0013F24f Peach developing fruit mesocarp Pr... 46 0.81 1
(FC600150) CAXS12715.fwd CAXS Lottia gigantea from head, foo... 46 0.81 1
(DR912503) EST1104042 Aquilegia cDNA library Aquilegia formo... 38 0.83 2
(EU880744) Plateumaris sericea voucher Donaciinae218 elongat... 42 0.84 2
(EE852915) 021030OSPA1013087HT OSPA Ovis aries cDNA, mRNA se... 36 0.92 2
(AF364364) Exorista mella elongation factor 1 alpha gene, pa... 42 0.97 2
(FJ534856) Bullera dendrophila strain CBS 6074 elongation fa... 34 1.1 2
(AX110952) Sequence 1685 from Patent WO0123604. 40 1.1 2
(AY919296) Ornithoptera euphorion elongation factor 1 alpha ... 40 1.1 2
(AF402079) Saccharomyces kluyveri strain NRRL Y-12651 transl... 40 1.2 2
(U85670) Estigmene acrea elongation factor-1 alpha (EF-1a) g... 36 1.3 2
(CV846134) ID0AEE14BA02RM1 ID0AEE Acyrthosiphon pisum cDNA c... 38 1.5 2
(Z83655) P.volucre gene encoding elongation factor 1 alpha, ... 36 1.5 2
(FM972240) Glossina morsitans morsitans EST, clone GMsg105h0... 36 1.6 2
(EL911233) INIT2_44_E06.g1_A006 G5 trophont cDNA (INIT2) Ich... 40 1.6 2
(EL908929) INIT2_28_E04.b1_A006 G5 trophont cDNA (INIT2) Ich... 40 1.6 2
(CN583772) USDA-FP_126837 Acyrthosiphon pisum, Pea Aphid Acy... 38 1.7 2
(Z83670) C.analis gene encoding elongation factor 1 alpha, p... 36 1.7 2
(EL913245) INIT2_58_D04.g2_A006 G5 trophont cDNA (INIT2) Ich... 40 1.7 2
(Z83665) Hecabolus sp. gene encoding elongation factor 1 alp... 36 1.7 2
(BI941164) df18e05.y1 Wellcome CRC pRN3 St13 17 egg animal c... 34 1.8 2
(EL912421) INIT2_52_A02.b1_A006 G5 trophont cDNA (INIT2) Ich... 40 1.8 2
(EL912253) INIT2_51_A02.b1_A006 G5 trophont cDNA (INIT2) Ich... 40 1.8 2
(EG965914) AU_Ich_027B_G01 Whole organism normalized cDNA li... 40 1.8 2
(BX554864) Glossina morsitans morsitans (Tseatse fly) EST fr... 36 1.8 2
(EF421489) Oides decempunctatus Ef1a (Ef1a) gene, partial cds. 30 1.9 3

>(AY185333) Dictyostelium discoideum Hsp70 subfamily B suppressor 1
(HBS1) gene, partial cds.
Length = 953

Score = 644 bits (325), Expect = 0.0
Identities = 327/328 (99%)
Strand = Plus / Plus


Query: 1 atttcgcatgggtattggatgaacaagaggaagaacgtgagcgtggtgtaactatggatg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 108 atttcgcatgggtattggatgaacaagaggaagaacgtgagcgtggtgtaactatggatg 167


Query: 61 nttgtgtgcgttactttgaaacagagcatagaagaatcacactattggacgcaccaggtc 120
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 168 tttgtgtgcgttactttgaaacagagcatagaagaatcacactattggacgcaccaggtc 227


Query: 121 acagagatttcataccaaatatgatcagtggtacaactcaagcagatgttgcaatattat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 228 acagagatttcataccaaatatgatcagtggtacaactcaagcagatgttgcaatattat 287


Query: 181 taattaacgcatcagaatttgaagcaggtttctcagcggagggtcaaactaaagaacatg 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 288 taattaacgcatcagaatttgaagcaggtttctcagcggagggtcaaactaaagaacatg 347


Query: 241 ctttactcgcaaaatcattaggtatcatggaattaattgtagcagtcaataaaatggatt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 348 ctttactcgcaaaatcattaggtatcatggaattaattgtagcagtcaataaaatggatt 407


Query: 301 caatcgaatgggatcaatcacgttacga 328
||||||||||||||||||||||||||||
Sbjct: 408 caatcgaatgggatcaatcacgttacga 435

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 328,128,642
Number of extensions: 17709928
Number of successful extensions: 1258604
Number of sequences better than 10.0: 1151
Length of query: 328
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 305
Effective length of database: 99,442,330,388
Effective search space: 30329910768340
Effective search space used: 30329910768340
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

protein update 2009. 7.29
Homology vs Protein
Query= Contig-U03781-1 (Contig-U03781-1Q) /CSM_Contig/Contig-U03781-1Q.Seq.d
(328 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

T23393(T23393)hypothetical protein K07A12.4 - Caenorhabditis ele... 155 5e-37
Z81098_7(Z81098|pid:none) Caenorhabditis elegans Cosmid K07A12, ... 155 5e-37
BC044162_1(BC044162|pid:none) Danio rerio HBS1-like (S. cerevisi... 149 4e-35
BC073427_1(BC073427|pid:none) Xenopus laevis MGC80911 protein, m... 148 7e-35
(Q5R6Y0) RecName: Full=HBS1-like protein; &CR860346_1(CR860346|... 145 3e-34
AK166140_1(AK166140|pid:none) Mus musculus lung RCB-0558 LLC cDN... 145 3e-34
BC010251_1(BC010251|pid:none) Mus musculus Hbs1-like (S. cerevis... 145 3e-34
AK292656_1(AK292656|pid:none) Homo sapiens cDNA FLJ77957 complet... 145 3e-34
AK173091_1(AK173091|pid:none) Mus musculus mRNA for mKIAA1038 pr... 145 3e-34
AF087672_1(AF087672|pid:none) Mus musculus eRFS mRNA, complete c... 145 3e-34
AB028961_1(AB028961|pid:none) Homo sapiens mRNA for KIAA1038 pro... 145 3e-34
AK295545_1(AK295545|pid:none) Homo sapiens cDNA FLJ50159 complet... 145 3e-34
(Q9Y450) RecName: Full=HBS1-like protein; AltName: Full=ERFS; &... 145 3e-34
AK298336_1(AK298336|pid:none) Homo sapiens cDNA FLJ52343 complet... 145 3e-34
AK293573_1(AK293573|pid:none) Homo sapiens cDNA FLJ59477 complet... 145 3e-34
BT045574_1(BT045574|pid:none) Salmo salar clone ssal-rgf-525-146... 145 4e-34
AM039499_1(AM039499|pid:none) Hanseniaspora osmophila partial te... 144 7e-34
AF402064_1(AF402064|pid:none) Zygosaccharomyces lentus strain NR... 144 7e-34
AF402085_1(AF402085|pid:none) Kluyveromyces marxianus strain NRR... 144 7e-34
AM039503_1(AM039503|pid:none) Hanseniaspora vineae partial tef1 ... 144 7e-34
AF402065_1(AF402065|pid:none) Kluyveromyces bacillisporus strain... 144 7e-34
AF402089_1(AF402089|pid:none) Eremothecium sinecaudum strain NRR... 144 1e-33
AF402077_1(AF402077|pid:none) Kluyveromyces thermotolerans strai... 144 1e-33
AM039513_1(AM039513|pid:none) Hanseniaspora lachancei partial te... 144 1e-33
AF402062_1(AF402062|pid:none) Zygosaccharomyces kombuchaensis st... 144 1e-33
CU928170_492(CU928170|pid:none) Kluyveromyces thermotolerans str... 144 1e-33
AF402063_1(AF402063|pid:none) Zygosaccharomyces kombuchaensis st... 144 1e-33
AM039518_1(AM039518|pid:none) Hanseniaspora occidentalis var. ci... 144 1e-33
AF402079_1(AF402079|pid:none) Saccharomyces kluyveri strain NRRL... 144 1e-33
AM039511_1(AM039511|pid:none) Hanseniaspora pseudoguilliermondii... 144 1e-33
AF402054_1(AF402054|pid:none) Zygosaccharomyces rouxii strain NR... 143 2e-33
AK024258_1(AK024258|pid:none) Homo sapiens cDNA FLJ14196 fis, cl... 143 2e-33
AF402086_1(AF402086|pid:none) Kluyveromyces dobzhanskii strain N... 143 2e-33
AF402041_1(AF402041|pid:none) Tetrapisispora phaffii strain NRRL... 143 2e-33
AY130811_1(AY130811|pid:none) Saccharomyces cerevisiae NRRL YB-2... 143 2e-33
AF402083_1(AF402083|pid:none) Kluyveromyces lactis strain NRRL Y... 143 2e-33
AM039502_1(AM039502|pid:none) Hanseniaspora valbyensis partial t... 143 2e-33
AF402067_1(AF402067|pid:none) Hanseniaspora valbyensis strain NR... 143 2e-33
(P02994) RecName: Full=Elongation factor 1-alpha; Short... 143 2e-33
AF402030_1(AF402030|pid:none) Kluyveromyces delphensis strain NR... 143 2e-33
AF402009_1(AF402009|pid:none) Saccharomyces mikatae strain NRRL ... 143 2e-33
CR382122_362(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 143 2e-33
AF402045_1(AF402045|pid:none) Naumovia castellii strain NRRL Y-1... 143 2e-33
AF402007_1(AF402007|pid:none) Saccharomyces paradoxus strain NRR... 143 2e-33
AM039500_1(AM039500|pid:none) Hanseniaspora uvarum partial tef1 ... 143 2e-33
AF402061_1(AF402061|pid:none) Zygosaccharomyces bisporus strain ... 143 2e-33
AF402042_1(AF402042|pid:none) Tetrapisispora nanseiensis strain ... 143 2e-33
AF402075_1(AF402075|pid:none) Zygosaccharomyces cidri strain NRR... 142 3e-33
AM039510_1(AM039510|pid:none) Hanseniaspora meyeri partial tef1 ... 142 3e-33
AF402048_1(AF402048|pid:none) Kluyveromyces yarrowii strain NRRL... 142 3e-33
AM039494_1(AM039494|pid:none) Hanseniaspora guilliermondii parti... 142 3e-33
AF402088_1(AF402088|pid:none) Eremothecium coryli strain NRRL Y-... 142 3e-33
AM039508_1(AM039508|pid:none) Hanseniaspora occidentalis var. ci... 142 3e-33
CR380950_46(CR380950|pid:none) Candida glabrata strain CBS138 ch... 142 3e-33
AM039509_1(AM039509|pid:none) Hanseniaspora opuntiae partial tef... 142 3e-33
AF402069_1(AF402069|pid:none) Hanseniaspora guilliermondii strai... 142 3e-33
AF402090_1(AF402090|pid:none) Eremothecium cymbalariae strain NR... 142 3e-33
AM039504_1(AM039504|pid:none) Hanseniaspora occidentalis var. oc... 142 3e-33
AF402033_1(AF402033|pid:none) Zygosaccharomyces mrakii strain NR... 142 4e-33
A29820_1(A29820|pid:none) A.gossypi translation elongation facto... 142 4e-33
AF402018_1(AF402018|pid:none) Saccharomyces unisporus strain NRR... 142 4e-33
AF402024_1(AF402024|pid:none) Kluyveromyces lodderae strain NRRL... 142 4e-33
AY130808_1(AY130808|pid:none) Saccharomyces pastorianus NRRL Y-2... 142 4e-33
AF402038_1(AF402038|pid:none) Candida humilis strain NRRL Y-7245... 142 4e-33
AF402051_1(AF402051|pid:none) Torulaspora franciscae strain NRRL... 142 4e-33
FB784609_1(FB784609|pid:none) Sequence 3882 from Patent WO200803... 142 4e-33
CR382136_102(CR382136|pid:none) Debaryomyces hansenii strain CBS... 142 4e-33
EF014948_1(EF014948|pid:none) Pichia pastoris translation elonga... 142 5e-33
AF402059_1(AF402059|pid:none) Zygosaccharomyces bailii strain NR... 142 5e-33
AF402040_1(AF402040|pid:none) Kluyveromyces blattae strain NRRL ... 142 5e-33
AF402080_1(AF402080|pid:none) Kluyveromyces aestuarii strain NRR... 142 5e-33
AF402012_1(AF402012|pid:none) Saccharomyces bayanus strain NRRL ... 142 5e-33
AF402015_1(AF402015|pid:none) Saccharomyces pastorianus strain N... 142 5e-33
FM992689_752(FM992689|pid:none) Candida dubliniensis CD36 chromo... 141 6e-33
AF402078_1(AF402078|pid:none) Kluyveromyces waltii strain NRRL Y... 141 6e-33
(P16017) RecName: Full=Elongation factor 1-alpha; Short... 141 6e-33
AF402035_1(AF402035|pid:none) Saccharomyces turicensis strain NR... 141 6e-33
FN357318_33(FN357318|pid:none) Schistosoma mansoni genome sequen... 141 6e-33
CP000496_913(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 141 6e-33
AY130813_1(AY130813|pid:none) Saccharomyces cerevisiae NRRL Y-12... 141 8e-33
AY849694_1(AY849694|pid:none) Magnaporthe grisea elongation fact... 141 8e-33
AM039519_1(AM039519|pid:none) Hanseniaspora occidentalis var. ci... 141 8e-33
AF402020_1(AF402020|pid:none) Saccharomyces transvaalensis strai... 141 8e-33
DQ925279_1(DQ925279|pid:none) Puccinia poae-nemoralis voucher UM... 141 8e-33
EU307985_1(EU307985|pid:none) Williopsis saturnus var. mrakii st... 140 1e-32
EU307984_1(EU307984|pid:none) Williopsis saturnus var. mrakii st... 140 1e-32
EU307990_1(EU307990|pid:none) Williopsis saturnus var. suaveolen... 140 1e-32
AF402056_1(AF402056|pid:none) Zygosaccharomyces mellis strain NR... 140 1e-32
AE017342_477(AE017342|pid:none) Cryptococcus neoformans var. neo... 140 1e-32
AF402016_1(AF402016|pid:none) Saccharomyces pastorianus strain N... 140 1e-32
AF402014_1(AF402014|pid:none) Saccharomyces pastorianus strain N... 140 1e-32
AF402011_1(AF402011|pid:none) Saccharomyces kudriavzevii strain ... 140 1e-32
AF402066_1(AF402066|pid:none) Candida castellii strain NRRL Y-17... 140 1e-32
FN392319_1522(FN392319|pid:none) Pichia pastoris GS115 chromosom... 140 1e-32
DQ832327_1(DQ832327|pid:none) Lichinella iodopulchra isolate AFT... 140 1e-32
DQ925292_1(DQ925292|pid:none) Uromyces anthyllidis voucher DAR 7... 140 2e-32
EU736268_1(EU736268|pid:none) Mucor spinosus strain FSU283 trans... 140 2e-32
EU736258_1(EU736258|pid:none) Chaetocladium jonesii strain FSU86... 140 2e-32
DQ782919_1(DQ782919|pid:none) Peltula umbilicata isolate AFTOL-I... 139 2e-32
EF421061_1(EF421061|pid:none) Lyophyllum connatum strain DUKE-JM... 139 3e-32
AF054510_1(AF054510|pid:none) Yarrowia lipolytica translation el... 139 3e-32
EF203701_1(EF203701|pid:none) Mucor plumbeus strain A162 elongat... 139 3e-32
AY531884_1(AY531884|pid:none) Beauveria bassiana isolate 1153 tr... 139 4e-32
EU982007_1(EU982007|pid:none) Uromyces sommerfeltii voucher UME:... 139 4e-32
DQ782900_1(DQ782900|pid:none) Spiromastix warcupii isolate AFTOL... 139 4e-32
AY531949_1(AY531949|pid:none) Beauveria bassiana isolate 7044 tr... 139 4e-32
DQ925271_1(DQ925271|pid:none) Puccinia lagenophorae voucher DAR ... 139 4e-32
AY531907_1(AY531907|pid:none) Beauveria bassiana isolate 1969 tr... 139 4e-32
AY531918_1(AY531918|pid:none) Beauveria bassiana isolate 2857 tr... 139 4e-32
AY531899_1(AY531899|pid:none) Beauveria bassiana isolate 1685 tr... 139 4e-32
(Q00251) RecName: Full=Elongation factor 1-alpha; Short... 139 4e-32
AF402046_1(AF402046|pid:none) Saccharomyces dairenensis strain N... 139 4e-32
AY531917_1(AY531917|pid:none) Beauveria bassiana isolate 2641 tr... 139 4e-32
AY531887_1(AY531887|pid:none) Beauveria bassiana isolate 1359 tr... 139 4e-32
AY531948_1(AY531948|pid:none) Beauveria bassiana isolate 7043 tr... 139 4e-32
DQ925272_1(DQ925272|pid:none) Puccinia lapsanae voucher DAR LE38... 139 4e-32
AY883702_1(AY883702|pid:none) Beauveria bassiana strain ARSEF 72... 139 4e-32
AY531881_1(AY531881|pid:none) Beauveria bassiana isolate 1040 tr... 138 5e-32
DQ925270_1(DQ925270|pid:none) Puccinia hysterium voucher UME LE6... 138 5e-32
AF157264_1(AF157264|pid:none) Mucor circinelloides f. lusitanicu... 138 5e-32
DQ925294_1(DQ925294|pid:none) Uromyces viciae-fabae voucher UME ... 138 5e-32
DQ925288_1(DQ925288|pid:none) Puccinia urticae-caricis voucher U... 138 5e-32
EF421090_1(EF421090|pid:none) Trichopilus porphyrophaeus strain ... 138 5e-32
DQ925239_1(DQ925239|pid:none) Aecidium sp. DAR 75725 translation... 138 5e-32
AF157269_1(AF157269|pid:none) Mucor ramosissimus translation elo... 138 5e-32
DQ925287_1(DQ925287|pid:none) Puccinia urticae-caricis voucher U... 138 5e-32
AY531940_1(AY531940|pid:none) Beauveria bassiana isolate 5718 tr... 138 5e-32
EF203702_1(EF203702|pid:none) Mucor flavus strain CBS234.35 elon... 138 5e-32
AB097423_1(AB097423|pid:none) Coemansia mojavensis EF1a gene for... 138 5e-32
AY883689_1(AY883689|pid:none) Beauveria bassiana strain ARSEF 70... 138 5e-32
AY484874_1(AY484874|pid:none) Penicillium brevicompactum strain ... 138 5e-32
AF157241_1(AF157241|pid:none) Circinomucor circinelloides transl... 138 5e-32
DQ282607_1(DQ282607|pid:none) Cladochytrium replicatum isolate A... 138 5e-32
AY531950_1(AY531950|pid:none) Beauveria bassiana isolate 7047 tr... 138 5e-32
AY531943_1(AY531943|pid:none) Beauveria bassiana isolate 6721 tr... 138 5e-32
(P32769) RecName: Full=Elongation factor 1 alpha-like protein; ... 138 5e-32
AY531941_1(AY531941|pid:none) Beauveria bassiana isolate 652 tra... 138 5e-32
EU420127_1(EU420127|pid:none) Clavicipitaceae sp. CV-2008a trans... 138 7e-32
AY445082_1(AY445082|pid:none) Metarhizium anisopliae strain E6 t... 138 7e-32
DQ925257_1(DQ925257|pid:none) Puccinia arenariae voucher UME LE4... 138 7e-32
AF157248_1(AF157248|pid:none) Echinosporangium transversale tran... 138 7e-32
EU502826_1(EU502826|pid:none) Leptographium koreanum strain MUCL... 138 7e-32
DQ925240_1(DQ925240|pid:none) Cumminsiella mirabilissima voucher... 138 7e-32
DQ028582_1(DQ028582|pid:none) Bensingtonia yuccicola isolate AFT... 138 7e-32
AF157291_1(AF157291|pid:none) Saksenaea vasiformis translation e... 138 7e-32
DQ862130_1(DQ862130|pid:none) Beauveria bassiana isolate IBL0318... 138 7e-32
AF157231_1(AF157231|pid:none) Apophysomyces elegans translation ... 138 7e-32
DQ925253_1(DQ925253|pid:none) Puccinia aegopodii voucher UME LE1... 138 7e-32
FJ772239_1(FJ772239|pid:none) Rhizocarpon oederi strain AFTOL137... 138 7e-32
(P40911) RecName: Full=Elongation factor 1-alpha; Short... 138 7e-32
EU296791_1(EU296791|pid:none) Leptographium terebrantis strain C... 138 7e-32
EU296787_1(EU296787|pid:none) Leptographium sp. QL-2007a strain ... 138 7e-32
D45837_1(D45837|pid:none) Neurospora crassa DNA for elongation f... 138 7e-32
EU502824_1(EU502824|pid:none) Leptographium truncatum strain MUC... 138 7e-32
EU369176_1(EU369176|pid:none) Megalospora tuberculosa translatio... 138 7e-32
AY743665_1(AY743665|pid:none) Ambomucor seriatoinflatus translat... 138 7e-32
EU502823_1(EU502823|pid:none) Leptographium truncatum strain MUC... 138 7e-32
EU307986_1(EU307986|pid:none) Williopsis saturnus var. subsuffic... 138 7e-32
DQ463994_1(DQ463994|pid:none) Metarhizium robertsii strain ARSEF... 138 7e-32
DQ925255_1(DQ925255|pid:none) Puccinia alpina voucher UME LE87/0... 138 7e-32
DQ925275_1(DQ925275|pid:none) Puccinia malvacearum voucher DAR 7... 138 7e-32
AF516769_1(AF516769|pid:none) Tuber mesentericum strain M4 elong... 137 9e-32
AF157304_1(AF157304|pid:none) Zygorhynchus heterogamus translati... 137 9e-32
EU130546_1(EU130546|pid:none) Alternaria multirostrata strain CB... 137 9e-32
DQ883804_1(DQ883804|pid:none) Pleopsidium gobiense isolate AFTOL... 137 9e-32
AF056099_1(AF056099|pid:none) Euplotes aediculatus translation e... 137 9e-32
AF516770_1(AF516770|pid:none) Tuber aestivum strain E61 elongati... 137 9e-32
AF157263_1(AF157263|pid:none) Mucor amphibiorum translation elon... 137 9e-32
AF157232_1(AF157232|pid:none) Backusella circina translation elo... 137 9e-32
FJ469669_1(FJ469669|pid:none) Arthonia caesia isolate AFTOL-ID 7... 137 9e-32
AY628333_1(AY628333|pid:none) Actinomucor elegans var. elegans s... 137 9e-32
EU130543_1(EU130543|pid:none) Alternaria cassiae strain CBS 477.... 137 9e-32
AF157242_1(AF157242|pid:none) Cokeromyces recurvatus translation... 137 9e-32
AF516775_1(AF516775|pid:none) Tuber mesentericum strain MG elong... 137 9e-32
EU130548_1(EU130548|pid:none) Alternaria helianthiinficiens stra... 137 9e-32
AF157229_1(AF157229|pid:none) Actinomucor elegans translation el... 137 9e-32
DQ782896_1(DQ782896|pid:none) Trypethelium sp. DUKE 0000007 isol... 137 9e-32
AF157235_1(AF157235|pid:none) Blakeslea trispora translation elo... 137 9e-32
DQ883764_1(DQ883764|pid:none) Teloschistes exilis isolate AFTOL-... 137 9e-32
AF157256_1(AF157256|pid:none) Hyphomucor assamensis translation ... 137 9e-32
EU130544_1(EU130544|pid:none) Alternaria anagallidis var. anagal... 137 9e-32
AF157279_1(AF157279|pid:none) Poitrasia circinans translation el... 137 9e-32
AF516774_1(AF516774|pid:none) Tuber magnatum elongation factor 1... 137 9e-32
EF203703_1(EF203703|pid:none) Mucor mucedo strain CBS109.16 elon... 137 9e-32
AF157270_1(AF157270|pid:none) Mucor recurvus var. indicus transl... 137 9e-32
DQ366254_1(DQ366254|pid:none) Orceolina kerguelensis translation... 137 9e-32
EU736271_1(EU736271|pid:none) Zygorhynchus moelleri strain FSU77... 137 9e-32
AF450113_1(AF450113|pid:none) Harpochytrium sp. JEL94 translatio... 137 9e-32
AF516777_1(AF516777|pid:none) Tuber mesentericum strain M13 elon... 137 9e-32
AF157302_1(AF157302|pid:none) Utharomyces epallocaulus translati... 137 9e-32
EF408572_1(EF408572|pid:none) Ceratocystis savannae isolate CMW1... 137 9e-32
DQ366258_1(DQ366258|pid:none) Trapelia placodioides translation ... 137 9e-32
DQ414251_1(DQ414251|pid:none) Dendryphiella salina strain CBS 14... 137 9e-32
AF157234_1(AF157234|pid:none) Benjaminiella poitrasii translatio... 137 9e-32
AY628337_1(AY628337|pid:none) Actinomucor elegans var. elegans s... 137 9e-32
EU130545_1(EU130545|pid:none) Alternaria cretica strain CBS 1091... 137 9e-32
AF516778_1(AF516778|pid:none) Tuber mesentericum strain M1 elong... 137 9e-32
AY170353_1(AY170353|pid:none) Tuber aestivum strain E58 elongati... 137 9e-32
DQ648071_1(DQ648071|pid:none) Septobasidium sinuosum translation... 137 1e-31
DQ925263_1(DQ925263|pid:none) Puccinia coronata voucher UME LE63... 137 1e-31
DQ318036_1(DQ318036|pid:none) Apiognomonia errabunda translation... 137 1e-31
DQ056745_1(DQ056745|pid:none) Hypocrea lixii translation elongat... 137 1e-31
DQ648070_1(DQ648070|pid:none) Septobasidium pseudopedicellatum t... 137 1e-31
DQ925241_1(DQ925241|pid:none) Dietelia portoricensis voucher IMI... 137 1e-31
DQ925278_1(DQ925278|pid:none) Puccinia pazschkei voucher UME LE&... 137 1e-31
DQ648067_1(DQ648067|pid:none) Septobasidium mariani translation ... 137 1e-31
EU736264_1(EU736264|pid:none) Mortierella indohii strain FSU830 ... 137 1e-31
EU826385_1(EU826385|pid:none) Pilaira caucasica strain FSU6229 c... 137 1e-31
EF560586_1(EF560586|pid:none) Phakopsora pachyrhizi translation ... 137 1e-31
DQ925258_1(DQ925258|pid:none) Puccinia bistortae voucher UME LE4... 137 1e-31
DQ648073_1(DQ648073|pid:none) Septobasidium taxodii translation ... 137 1e-31
AF157293_1(AF157293|pid:none) Sporodiniella umbellata translatio... 137 1e-31
AB281529_1(AB281529|pid:none) Rhizopus oryzae EF-1alpha gene for... 137 1e-31
DQ925245_1(DQ925245|pid:none) Puccinia actaeae-agropyri voucher ... 137 1e-31
DQ648064_1(DQ648064|pid:none) Septobasidium ramorum translation ... 137 1e-31
DQ925267_1(DQ925267|pid:none) Puccinia graminis f. tritici strai... 137 1e-31
DQ838540_1(DQ838540|pid:none) Hypocrea rufa strain CPK 1008 tran... 137 1e-31
DQ838538_1(DQ838538|pid:none) Hypocrea rufa strain CPK 1006 tran... 137 1e-31
AF157246_1(AF157246|pid:none) Dicranophora fulva translation elo... 137 1e-31
DQ925248_1(DQ925248|pid:none) Puccinia agropyrina voucher UME LE... 137 1e-31
AB116235_1(AB116235|pid:none) Rosellinia sp. PF1022 tef1 gene fo... 137 1e-31
AB281527_1(AB281527|pid:none) Rhizopus oryzae EF-1alpha gene for... 137 1e-31
(Q9Y713) RecName: Full=Elongation factor 1-alpha; Short... 137 1e-31
AF157254_1(AF157254|pid:none) Helicostylum elegans translation e... 137 1e-31
DQ883773_1(DQ883773|pid:none) Heterodermia vulgaris isolate AFTO... 137 1e-31
AF157276_1(AF157276|pid:none) Pilaira anomala translation elonga... 137 1e-31
DQ648072_1(DQ648072|pid:none) Septobasidium meredithiae translat... 137 1e-31
(P14864) RecName: Full=Elongation factor 1-alpha; Short... 137 1e-31
EU982006_1(EU982006|pid:none) Uromyces polygoni-avicularis vouch... 137 1e-31
EF433315_1(EF433315|pid:none) Ceratocystis fimbriata voucher CMW... 137 2e-31
EU401577_1(EU401577|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
FJ619249_1(FJ619249|pid:none) Hypocrea lixii strain OY3207 trans... 137 2e-31
EU401593_1(EU401593|pid:none) Hypocrea orientalis strain G.J.S 9... 137 2e-31
FJ618580_1(FJ618580|pid:none) Hypocrea lixii isolate AS16-1 tran... 137 2e-31
FJ618578_1(FJ618578|pid:none) Hypocrea lixii isolate SS6-1 trans... 137 2e-31
EU401627_1(EU401627|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
DQ925266_1(DQ925266|pid:none) Puccinia graminis voucher DAR 7472... 137 2e-31
EU401595_1(EU401595|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
FJ618581_1(FJ618581|pid:none) Hypocrea lixii isolate AS16-3 tran... 137 2e-31
EF408576_1(EF408576|pid:none) Ceratocystis tsitsikammensis isola... 137 2e-31
FJ618579_1(FJ618579|pid:none) Hypocrea lixii isolate AS15-1 tran... 137 2e-31
FJ618575_1(FJ618575|pid:none) Hypocrea virens isolate AS3-4 tran... 137 2e-31
AF157272_1(AF157272|pid:none) Mycotypha microspora translation e... 137 2e-31
EU401579_1(EU401579|pid:none) Hypocrea orientalis strain PPRI 38... 137 2e-31
FJ619256_1(FJ619256|pid:none) Trichoderma sp. OY14707 translatio... 137 2e-31
EU244929_1(EU244929|pid:none) Ceratocystis sp. RNH-2008d isolate... 137 2e-31
EU498316_1(EU498316|pid:none) Hypocrea brunneoviridis strain CBS... 137 2e-31
EU401602_1(EU401602|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
FJ618568_1(FJ618568|pid:none) Trichoderma atroviride isolate AS8... 137 2e-31
FJ618572_1(FJ618572|pid:none) Trichoderma hamatum isolate SS11-2... 137 2e-31
EU401590_1(EU401590|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
DQ641674_1(DQ641674|pid:none) Trichoderma sp. CPK 1011 translati... 137 2e-31
EF070400_1(EF070400|pid:none) Ceratocystis albifundus strain CMW... 137 2e-31
DQ282618_1(DQ282618|pid:none) Endogone pisiformis isolate AFTOL-... 137 2e-31
AF402060_1(AF402060|pid:none) Zygosaccharomyces bailii strain NR... 137 2e-31
DQ282608_1(DQ282608|pid:none) Neocallimastix sp. GE13 isolate AF... 137 2e-31
EU498312_1(EU498312|pid:none) Hypocrea alni strain CBS120633 tra... 137 2e-31
EU401621_1(EU401621|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
AF402093_1(AF402093|pid:none) Schizosaccharomyces pombe strain N... 137 2e-31
EU498317_1(EU498317|pid:none) Hypocrea brunneoviridis strain CPK... 137 2e-31
FJ618571_1(FJ618571|pid:none) Trichoderma hamatum isolate DS302 ... 137 2e-31
EF421089_1(EF421089|pid:none) Rhodocybe fallax strain CBS129.63 ... 137 2e-31
AF157287_1(AF157287|pid:none) Rhizopus microsporus var. rhizopod... 137 2e-31
DQ845416_1(DQ845416|pid:none) Trichoderma viride strain UNISS 4-... 137 2e-31
DQ925242_1(DQ925242|pid:none) Gymnosporangium clavariiforme vouc... 137 2e-31
DQ883771_1(DQ883771|pid:none) Lobariella pallida isolate AFTOL-I... 137 2e-31
AB097425_1(AB097425|pid:none) Syncephalis depressa EF-1a gene fo... 137 2e-31
DQ883765_1(DQ883765|pid:none) Letrouitia domingensis isolate AFT... 137 2e-31
FJ629374_1(FJ629374|pid:none) Trichoderma atroviride strain OY38... 137 2e-31
EU401599_1(EU401599|pid:none) Hypocrea orientalis strain UAMH 95... 137 2e-31
EU918160_1(EU918160|pid:none) Trichoderma pleuroticola strain CP... 137 2e-31
(Q10119) RecName: Full=Elongation factor 1-alpha-B/C; S... 137 2e-31
FJ618569_1(FJ618569|pid:none) Trichoderma atroviride isolate DS1... 137 2e-31
FJ619253_1(FJ619253|pid:none) Hypocrea lixii strain OY1107 trans... 137 2e-31
EU401594_1(EU401594|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
FJ904549_1(FJ904549|pid:none) Herpotrichia juniperi strain T01 2... 137 2e-31
EU401600_1(EU401600|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
EU498313_1(EU498313|pid:none) Hypocrea alni strain CPK2494 trans... 137 2e-31
EU401589_1(EU401589|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
DQ282612_1(DQ282612|pid:none) Scutellospora heterogama isolate A... 137 2e-31
(P34825) RecName: Full=Elongation factor 1-alpha; Short... 137 2e-31
DQ925243_1(DQ925243|pid:none) Ochropsora ariae voucher UME LE127... 137 2e-31
FJ618584_1(FJ618584|pid:none) Hypocrea lixii isolate SS6-2 trans... 137 2e-31
EU736250_1(EU736250|pid:none) Lentamyces parricida strain FSU547... 137 2e-31
EU401619_1(EU401619|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
AF157273_1(AF157273|pid:none) Parasitella parasitica translation... 137 2e-31
EF433320_1(EF433320|pid:none) Ceratocystis sp. MVW-2007d voucher... 137 2e-31
DQ364633_1(DQ364633|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
FJ619250_1(FJ619250|pid:none) Trichoderma sp. OY2407 translation... 137 2e-31
(Q96WZ1) RecName: Full=Elongation factor 1-alpha; Short... 137 2e-31
FJ619254_1(FJ619254|pid:none) Hypocrea orientalis strain OY2607 ... 137 2e-31
EF433316_1(EF433316|pid:none) Ceratocystis fimbriata voucher CMW... 137 2e-31
AY665707_1(AY665707|pid:none) Trichoderma viride D isolate CPK99... 137 2e-31
EU401586_1(EU401586|pid:none) Trichoderma longibrachiatum strain... 137 2e-31
EU498314_1(EU498314|pid:none) Hypocrea alni strain CPK2854 trans... 137 2e-31
AF402036_1(AF402036|pid:none) Saccharomyces bulderi strain NRRL ... 136 2e-31
EU736265_1(EU736265|pid:none) Mortierella minutissima strain FSU... 136 2e-31
DQ028603_1(DQ028603|pid:none) Trametes versicolor isolate AFTOL-... 136 2e-31
AE014296_397(AE014296|pid:none) Drosophila melanogaster chromoso... 136 2e-31
DQ282605_1(DQ282605|pid:none) Monoblepharella sp. M15 isolate AF... 136 2e-31
AF157255_1(AF157255|pid:none) Hesseltinella vesiculosa translati... 136 2e-31
AF157262_1(AF157262|pid:none) Mortierella verticillata translati... 136 2e-31
DQ842008_1(DQ842008|pid:none) Dibaeis baeomyces isolate AFTOL-ID... 136 2e-31
DQ282615_1(DQ282615|pid:none) Coemansia reversa isolate AFTOL-ID... 136 2e-31
DQ925282_1(DQ925282|pid:none) Puccinia ribesii-caricis voucher U... 136 2e-31
(P90519) RecName: Full=Elongation factor 1-alpha; Short... 136 2e-31
(P50522) RecName: Full=Elongation factor 1-alpha-A; Sho... 136 2e-31
DQ925280_1(DQ925280|pid:none) Puccinia poarum voucher UME LE75/0... 136 2e-31
EF421056_1(EF421056|pid:none) Lyophyllum favrei strain IE-BSG-HC... 136 2e-31
(Q01765) RecName: Full=Elongation factor 1-alpha; Short... 136 2e-31
FJ772246_1(FJ772246|pid:none) Nephroma parile strain AFTOL131 el... 136 2e-31
DQ028602_1(DQ028602|pid:none) Phaeolus schweinitzii isolate AFTO... 136 2e-31
EU736249_1(EU736249|pid:none) Absidia macrospora strain FSU4746 ... 136 2e-31
EU736263_1(EU736263|pid:none) Mortierella alpina strain FSU695 t... 136 2e-31
DQ282606_1(DQ282606|pid:none) Hyaloraphidium curvatum isolate AF... 136 2e-31
U69697_1(U69697|pid:none) Cryptosporidium parvum elongation fact... 136 2e-31
DQ883803_1(DQ883803|pid:none) Ramalina complanata isolate AFTOL-... 136 3e-31
AY628332_1(AY628332|pid:none) Actinomucor elegans var. meitauzae... 136 3e-31
AM270233_7(AM270233|pid:none) Aspergillus niger contig An11c0160... 136 3e-31
EU736247_1(EU736247|pid:none) Absidia californica strain FSU4748... 136 3e-31
EU736253_1(EU736253|pid:none) Absidia spinosa strain FSU551 tran... 136 3e-31
AF157275_1(AF157275|pid:none) Phycomyces blakesleeanus translati... 136 3e-31
DQ059048_1(DQ059048|pid:none) Ganoderma tsugae isolate AFTOL-ID ... 136 3e-31
DQ782889_1(DQ782889|pid:none) Canoparmelia caroliniana isolate A... 136 3e-31
AF157226_1(AF157226|pid:none) Absidia coerulea translation elong... 136 3e-31
EU736245_1(EU736245|pid:none) Absidia caerulea strain FSU786 tra... 136 3e-31
EF413607_1(EF413607|pid:none) Capronia munkii translation elonga... 136 3e-31
DQ782895_1(DQ782895|pid:none) Echinoplaca strigulacea isolate AF... 136 3e-31
DQ883763_1(DQ883763|pid:none) Flavoparmelia caperata isolate AFT... 136 3e-31
AM183922_1(AM183922|pid:none) Geosiphon pyriformis partial ef1a ... 136 3e-31
DQ840566_1(DQ840566|pid:none) Exophiala dermatitidis isolate AFT... 136 3e-31
EU736254_1(EU736254|pid:none) Absidia spinosa strain FSU552 tran... 136 3e-31
EU257537_1(EU257537|pid:none) Tilletia fusca voucher WSP 71275 t... 136 3e-31
EF421058_1(EF421058|pid:none) Calocybe obscurissima strain IE-BS... 136 3e-31
AF157260_1(AF157260|pid:none) Mortierella multidivaricata transl... 136 3e-31
AF157247_1(AF157247|pid:none) Dissophora decumbens translation e... 136 3e-31
AF157277_1(AF157277|pid:none) Pilobolus umbonatus translation el... 136 3e-31
DQ782917_1(DQ782917|pid:none) Agonimia sp. AFTOL 684 elongation ... 136 3e-31
(P28295) RecName: Full=Elongation factor 1-alpha; Short... 136 3e-31
DQ782898_1(DQ782898|pid:none) Mycoblastus sanguinarius isolate A... 136 3e-31
AY883429_1(AY883429|pid:none) Suillus pictus isolate AFTOL-ID 71... 135 3e-31
DQ366251_1(DQ366251|pid:none) Diploschistes ocellatus translatio... 135 3e-31
FJ904548_1(FJ904548|pid:none) Herpotrichia juniperi strain T01 1... 135 3e-31
AY443452_1(AY443452|pid:none) Penicillium waksmanii isolate NRRL... 135 3e-31
AY443451_1(AY443451|pid:none) Penicillium manginii isolate NRRL ... 135 3e-31
EF421063_1(EF421063|pid:none) Lyophyllum ambustum strain CBS452.... 135 3e-31
DQ782901_1(DQ782901|pid:none) Lecanora hybocarpa isolate AFTOL-I... 135 3e-31
DQ782892_1(DQ782892|pid:none) Physcia aipolia isolate AFTOL-ID 8... 135 3e-31
DQ648058_1(DQ648058|pid:none) Septobasidium apiculatum translati... 135 3e-31
AY582823_1(AY582823|pid:none) Chytriomyces confervae strain CBS ... 135 3e-31
AY885151_1(AY885151|pid:none) Climacodon septentrionalis isolate... 135 3e-31
EF421072_1(EF421072|pid:none) Ossicaulis lignatilis strain DUKE-... 135 3e-31
EU812463_1(EU812463|pid:none) Puccinia psidii voucher 1210 trans... 135 3e-31
DQ883774_1(DQ883774|pid:none) Diploschistes cinereocaesius isola... 135 3e-31
DQ029199_1(DQ029199|pid:none) Aureoboletus thibetanus isolate AF... 135 3e-31
FJ904561_1(FJ904561|pid:none) Herpotrichia juniperi strain T01 2... 135 3e-31
DQ925301_1(DQ925301|pid:none) Uromyces sp. DAR 75707 translation... 135 3e-31
(A8ABM5) RecName: Full=Elongation factor 1-alpha; Short... 135 3e-31
(P32186) RecName: Full=Elongation factor 1-alpha; Short... 135 3e-31
AY443453_1(AY443453|pid:none) Penicillium miczynskii isolate NRR... 135 3e-31
D89112_1(D89112|pid:none) Schizosaccharomyces pombe mRNA, partia... 135 3e-31
EF421055_1(EF421055|pid:none) Calocybe fallax strain IE-BSG-HC80... 135 3e-31
DQ282616_1(DQ282616|pid:none) Rhopalomyces elegans isolate AFTOL... 135 4e-31
(P41745) RecName: Full=Elongation factor 1-alpha; Short... 135 4e-31
DQ782894_1(DQ782894|pid:none) Anisomeridium polypori isolate AFT... 135 4e-31
EU401616_1(EU401616|pid:none) Trichoderma sp. PPRC H5 translatio... 135 4e-31
EF413612_1(EF413612|pid:none) Exophiala salmonis translation elo... 135 4e-31
EF421067_1(EF421067|pid:none) Lyophyllum decastes strain JM-Hon/... 135 4e-31
AJ970312_1(AJ970312|pid:none) Hebeloma cylindrosporum mRNA for e... 135 4e-31
CR382135_148(CR382135|pid:none) Debaryomyces hansenii strain CBS... 135 4e-31
AY443450_1(AY443450|pid:none) Penicillium rolfsii isolate NRRL 1... 135 4e-31
DQ059049_1(DQ059049|pid:none) Albatrellus higanensis isolate AFT... 135 4e-31
AY883427_1(AY883427|pid:none) Hygrophoropsis aurantiaca isolate ... 135 4e-31
EF421065_1(EF421065|pid:none) Lyophyllum atratum strain CBS709.8... 135 4e-31
EF421070_1(EF421070|pid:none) Tephrocybe boudieri strain IE-BSG-... 135 4e-31
AM270408_32(AM270408|pid:none) Aspergillus niger contig An18c016... 135 4e-31
AY484854_1(AY484854|pid:none) Penicillium biourgeianum strain NR... 135 4e-31
EF421075_1(EF421075|pid:none) Tephrocybe palustris strain CBS717... 135 4e-31
DQ782893_1(DQ782893|pid:none) Dermatocarpon miniatum isolate AFT... 135 4e-31
(Q9YAV0) RecName: Full=Elongation factor 1-alpha; Short... 135 4e-31
EF421073_1(EF421073|pid:none) Tephrocybe gibberosa strain CBS328... 135 4e-31
EF421086_1(EF421086|pid:none) Clitopilus sp. VHAs07/02 elongatio... 135 4e-31
EF421076_1(EF421076|pid:none) Tephrocybe rancida strain CBS204.4... 135 4e-31
EF421081_1(EF421081|pid:none) Clitocybe nebularis strain CBS362.... 135 4e-31
EF070396_1(EF070396|pid:none) Ceratocystis platani strain CMW148... 135 4e-31
DQ925291_1(DQ925291|pid:none) Uromyces acetosae voucher UME LE51... 135 4e-31
AF157252_1(AF157252|pid:none) Gongronella butleri translation el... 135 4e-31
AY484875_1(AY484875|pid:none) Penicillium brevicompactum strain ... 135 4e-31
AY484853_1(AY484853|pid:none) Penicillium canescens strain NRRL ... 135 4e-31
AY484860_1(AY484860|pid:none) Penicillium biourgeianum strain NR... 135 4e-31
EF421064_1(EF421064|pid:none) Lyophyllum anthracophilum strain I... 135 4e-31
AF157244_1(AF157244|pid:none) Cunninghamella echinulata translat... 135 4e-31
AY741757_1(AY741757|pid:none) Penicillium chermesinum strain NRR... 135 4e-31
EF070402_1(EF070402|pid:none) Ceratocystis sp. MVW-2007a strain ... 135 4e-31
EF421069_1(EF421069|pid:none) Lyophyllum sykosporum strain IFO30... 135 4e-31
EU307982_1(EU307982|pid:none) Williopsis saturnus var. saturnus ... 135 6e-31
EF421080_1(EF421080|pid:none) Clitocybe dealbata strain IE-BSG-H... 135 6e-31
EF421088_1(EF421088|pid:none) Nolanea strictior strain DUKE-JM96... 135 6e-31
DQ282609_1(DQ282609|pid:none) Dimargaris bacillispora isolate AF... 135 6e-31
EU736259_1(EU736259|pid:none) Cunninghamella bainieri strain FSU... 135 6e-31
EF421060_1(EF421060|pid:none) Gerhardtia sp. HC01/025 elongation... 135 6e-31
AF056108_1(AF056108|pid:none) Stylonychia mytilus translation el... 135 6e-31
AF157300_1(AF157300|pid:none) Umbelopsis isabellina translation ... 135 6e-31
AB097424_1(AB097424|pid:none) Dimargaris cristalligena EF-1a gen... 135 6e-31
AF016239_1(AF016239|pid:none) Rhodotorula mucilaginosa protein s... 135 6e-31
AY170357_1(AY170357|pid:none) Tuber aestivum strain E2 elongatio... 135 6e-31
AY741761_1(AY741761|pid:none) Penicillium brocae strain NRRL 314... 135 6e-31
AB077103_1(AB077103|pid:none) Piptocephalis freseniana EF-1 alph... 135 6e-31
CU928170_747(CU928170|pid:none) Kluyveromyces thermotolerans str... 135 6e-31
DQ925246_1(DQ925246|pid:none) Puccinia actaeae-agropyri voucher ... 135 6e-31
EU826384_1(EU826384|pid:none) Absidia hyalospora strain FSU5796 ... 134 8e-31
EU826400_1(EU826400|pid:none) Absidia idahoensis var. thermophil... 134 8e-31
EU826382_1(EU826382|pid:none) Absidia idahoensis var. thermophil... 134 8e-31
DQ925268_1(DQ925268|pid:none) Puccinia graminis f. tritici strai... 134 8e-31
U81803_1(U81803|pid:none) Filobasidiella neoformans translation ... 134 8e-31
AF450114_1(AF450114|pid:none) Rhizophlyctis harderi translation ... 134 8e-31
AP006852_395(AP006852|pid:none) Candida albicans genomic DNA, ch... 134 8e-31
EU826402_1(EU826402|pid:none) Absidia hyalospora strain FSU5796 ... 134 8e-31
EF560589_1(EF560589|pid:none) Uredo sp. DAR75672 translation elo... 134 8e-31
AY741759_1(AY741759|pid:none) Penicillium fellutanum strain NRRL... 134 8e-31
AF157294_1(AF157294|pid:none) Syncephalastrum monosporum var. pl... 134 8e-31
AY582826_1(AY582826|pid:none) Corallochytrium limacisporum ef1a ... 134 8e-31
D82573_1(D82573|pid:none) Schizosaccharomyces pombe mRNA for elo... 134 8e-31
AY885152_1(AY885152|pid:none) Fomitopsis pinicola isolate AFTOL-... 134 8e-31
AY741756_1(AY741756|pid:none) Penicillium charlesii strain NRRL ... 134 8e-31
AF157282_1(AF157282|pid:none) Rhizomucor miehei translation elon... 134 8e-31
AF157295_1(AF157295|pid:none) Syncephalastrum racemosum translat... 134 8e-31
AF157258_1(AF157258|pid:none) Micromucor ramannianus translation... 134 8e-31
DQ999853_1(DQ999853|pid:none) Monacrosporium ellipsosporum strai... 134 8e-31
AF450115_1(AF450115|pid:none) Rhizophydium sp. JEL136 translatio... 134 8e-31
EF421084_1(EF421084|pid:none) Tricholoma portentosum strain KMS5... 134 8e-31
DQ282617_1(DQ282617|pid:none) Rhizophlyctis rosea isolate AFTOL-... 134 8e-31
(O42820) RecName: Full=Elongation factor 1-alpha; Short... 134 8e-31
EF421059_1(EF421059|pid:none) Calocybe persicolor strain IE-BSG-... 134 8e-31
DQ282601_1(DQ282601|pid:none) Rhizoclosmatium sp. JEL347-h isola... 134 8e-31
AF157225_1(AF157225|pid:none) Absidia blakesleeana translation e... 134 8e-31
DQ282602_1(DQ282602|pid:none) Batrachochytrium dendrobatidis iso... 134 1e-30
DQ358228_1(DQ358228|pid:none) Arthrobotrys entomopaga elongation... 134 1e-30
DQ782902_1(DQ782902|pid:none) Bacidia schweinitzii isolate AFTOL... 134 1e-30
FM992694_391(FM992694|pid:none) Candida dubliniensis CD36 chromo... 134 1e-30
AF056096_1(AF056096|pid:none) Blepharisma japonicum translation ... 134 1e-30
U81804_1(U81804|pid:none) Filobasidiella neoformans translation ... 134 1e-30
DQ999835_1(DQ999835|pid:none) Dactylella copepodii strain CBS 48... 134 1e-30
AY741758_1(AY741758|pid:none) Penicillium phoeniceum strain NRRL... 134 1e-30
DQ403163_1(DQ403163|pid:none) Capsaspora owczarzaki translation ... 134 1e-30
DQ925265_1(DQ925265|pid:none) Puccinia graminis voucher DAR 7481... 134 1e-30
EU736255_1(EU736255|pid:none) Lentamyces zychae strain FSU5797 t... 134 1e-30
S70636(S70636) translation elongation factor eEF-1 alpha chain -... 134 1e-30
FJ807252_1(FJ807252|pid:none) Bodo saltans strain CCAP 1907/2 el... 134 1e-30
EF421079_1(EF421079|pid:none) Tricholomella constricta strain IE... 134 1e-30
AB007029_1(AB007029|pid:none) Unidentified Oxymonadida A-14 mRNA... 134 1e-30
DQ999848_1(DQ999848|pid:none) Dactylellina sp. XZ04-92-1 elongat... 134 1e-30
AF157236_1(AF157236|pid:none) Chaetocladium brefeldii translatio... 134 1e-30
DQ883769_1(DQ883769|pid:none) Pseudocyphellaria anomala isolate ... 134 1e-30
DQ999844_1(DQ999844|pid:none) Monacrosporium drechsleri strain X... 134 1e-30
DQ999842_1(DQ999842|pid:none) Monacrosporium drechsleri strain X... 134 1e-30
AF157299_1(AF157299|pid:none) Thermomucor indicae-seudaticae tra... 134 1e-30
DQ999840_1(DQ999840|pid:none) Monacrosporium drechsleri strain C... 133 2e-30
EU826380_1(EU826380|pid:none) Dichotomocladium robustum strain F... 133 2e-30
AY643817_1(AY643817|pid:none) Fuligo septica elongation factor 1... 133 2e-30
AF157245_1(AF157245|pid:none) Dichotomocladium elegans translati... 133 2e-30
DQ367425_1(DQ367425|pid:none) Calocybe carnea strain CBS552.50 e... 133 2e-30
DQ999852_1(DQ999852|pid:none) Monacrosporium arcuatum strain CBS... 133 2e-30
DQ999846_1(DQ999846|pid:none) Arthrobotrys gephyropaga strain CB... 133 2e-30
AF056105_1(AF056105|pid:none) Spathidium sp. translation elongat... 133 2e-30
DQ999839_1(DQ999839|pid:none) Monacrosporium drechsleri strain F... 133 2e-30
DQ665315_1(DQ665315|pid:none) Nyctotherus ovalis clone 2 elongat... 133 2e-30
AY305483_1(AY305483|pid:none) Macrobiotus islandicus elongation ... 133 2e-30
AF288066_1(AF288066|pid:none) Grillotia erinaceus elongation fac... 133 2e-30
AY582825_1(AY582825|pid:none) Ministeria vibrans strain ATCC 505... 133 2e-30
DQ367424_1(DQ367424|pid:none) Asterophora agaricoides strain CBS... 133 2e-30
AF450116_1(AF450116|pid:none) Ichthyophonus irregularis translat... 133 2e-30
EF421077_1(EF421077|pid:none) Termitomyces microcarpus strain DU... 133 2e-30
EF421085_1(EF421085|pid:none) Tricholoma subaureum strain KMS590... 133 2e-30
AY582829_1(AY582829|pid:none) Acanthamoeba culbertsoni ef1a gene... 133 2e-30
DQ925140_1(DQ925140|pid:none) Oxymonadida environmental sample c... 133 2e-30
EU257525_1(EU257525|pid:none) Tilletia secalis voucher WSP 71279... 132 3e-30
AB306940_1(AB306940|pid:none) Echinococcus shiquicus ef1a gene f... 132 3e-30
AF157243_1(AF157243|pid:none) Cunninghamella bertholletiae trans... 132 3e-30
DQ367426_1(DQ367426|pid:none) Lyophyllum decastes strain JM87/16... 132 3e-30
AF056098_1(AF056098|pid:none) Colpoda inflata translation elonga... 132 3e-30
EF421068_1(EF421068|pid:none) Lyophyllum semitale strain IE-BSG-... 132 3e-30
EF421078_1(EF421078|pid:none) Termitomyces sp. IE-BSG-BSIsp.1 el... 132 3e-30
AB306938_1(AB306938|pid:none) Echinococcus vogeli ef1a gene for ... 132 3e-30
AK100658_1(AK100658|pid:none) Oryza sativa Japonica Group cDNA c... 132 3e-30
EU257552_1(EU257552|pid:none) Tilletia vankyi voucher WSP 71270 ... 132 3e-30
FJ772247_1(FJ772247|pid:none) Lopezaria versicolor strain AFTOL1... 132 4e-30
AK073254_1(AK073254|pid:none) Oryza sativa Japonica Group cDNA c... 132 4e-30
(P41203) RecName: Full=Elongation factor 1-alpha; Short... 132 4e-30
AP008207_113(AP008207|pid:none) Oryza sativa (japonica cultivar-... 132 4e-30
CP001140_1365(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 132 4e-30
AY580285_1(AY580285|pid:none) Strongylocentrotus purpuratus elon... 132 4e-30
S54734(S54734;S38464)translation elongation factor aEF-1 alpha c... 132 4e-30
DQ648059_1(DQ648059|pid:none) Septobasidium burtii translation e... 132 5e-30
DQ925122_1(DQ925122|pid:none) Oxymonadida environmental sample c... 132 5e-30
AF288072_1(AF288072|pid:none) Aphanastoma virescens elongation f... 132 5e-30
DQ925124_1(DQ925124|pid:none) Oxymonadida environmental sample c... 132 5e-30
DQ925153_1(DQ925153|pid:none) Oxymonadida environmental sample c... 132 5e-30
AB077104_1(AB077104|pid:none) Smittium culisetae EF-1 alpha gene... 132 5e-30
DQ925157_1(DQ925157|pid:none) Oxymonadida environmental sample c... 132 5e-30

>T23393(T23393)hypothetical protein K07A12.4 - Caenorhabditis
elegans
Length = 936

Score = 155 bits (391), Expect = 5e-37
Identities = 75/110 (68%), Positives = 90/110 (81%), Gaps = 2/110 (1%)
Frame = +3

Query: 3 FAWVLDEQEEERERGVTMDXCVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILL 182
+AWVLDE EEERERGVTMD FET HRRI LLDAPGH+DFI NMI+GT+QAD AIL+
Sbjct: 547 YAWVLDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILV 606

Query: 183 INAS--EFEAGFSAEGQTKEHALLAKSLGIMELIVAVNKMDSIEWDQSRY 326
+NA+ EFE GF GQTKEHALL +SLG+ +LIVAVNK+D+++W Q R+
Sbjct: 607 VNATTGEFETGFENGGQTKEHALLLRSLGVTQLIVAVNKLDTVDWSQDRF 656

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 509,058,998
Number of extensions: 8850535
Number of successful extensions: 35799
Number of sequences better than 10.0: 11243
Number of HSP's gapped: 27935
Number of HSP's successfully gapped: 11246
Length of query: 109
Length of database: 1,061,185,681
Length adjustment: 77
Effective length of query: 32
Effective length of database: 809,515,185
Effective search space: 25904485920
Effective search space used: 25904485920
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 28 (15.4 bits)

PSORT

psg: 0.75 gvh: 0.40 alm: 0.34 top: 0.53 tms: 0.00 mit: 0.21 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

60.0 %: cytoplasmic
24.0 %: nuclear
8.0 %: vesicles of secretory system
4.0 %: cytoskeletal
4.0 %: mitochondrial

>> prediction for Contig-U03781-1 is cyt

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 1
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0