NC_005042
Chromosome NC_005042
Query gi|33240879
Alignment
>1y44B 1 305 2 313 1e-89
ref|NP_875821.1| Metallo-beta-lactamase superfamily enzyme [Prochlorococcus marinus
subsp. marinus str. CCMP1375] gb|AAQ00474.1|
Metallo-beta-lactamase superfamily enzyme
[Prochlorococcus marinus subsp. marinus str. CCMP1375]
sp|Q7VAN0|RNZ_PROMA Ribonuclease Z (RNase Z) (tRNase Z)
(tRNA 3 endonuclease)
Length = 312



Score = 488 bits (1852), Expect = e-137
Identities = 295/312 (94%), Positives = 295/312 (94%)

Query: 2 QITFLGTSSGVPTRSRNVSALALRLPQRSELWLFDCGEGTQHQFLRSDLRTSQLKKIFIT 61
QITFLGTSSGVPTRSRNVSALALRLPQRSELWLFDCGEGTQHQFLRSDLRTSQLKKIFIT
Sbjct: 1 QITFLGTSSGVPTRSRNVSALALRLPQRSELWLFDCGEGTQHQFLRSDLRTSQLKKIFIT 60

Query: 62 HMHGDHIYGLPXXXXXXXXXXXXXXXXXYGPSALKGFLDGILKSSSSRISYPMKIHGLEL 121
HMHGDHIYGLP YGPSALKGFLDGILKSSSSRISYPMKIHGLEL
Sbjct: 61 HMHGDHIYGLPGLMASLGLAGNSLGLDLYGPSALKGFLDGILKSSSSRISYPMKIHGLEL 120

Query: 122 ESAENKIIFEDNDFLVTCTPLIHRVPAFAYRVDEKAKPGRFDVEKAKALRIPPGPIYSQL 181
ESAENKIIFEDNDFLVTCTPLIHRVPAFAYRVDEKAKPGRFDVEKAKALRIPPGPIYSQL
Sbjct: 121 ESAENKIIFEDNDFLVTCTPLIHRVPAFAYRVDEKAKPGRFDVEKAKALRIPPGPIYSQL 180

Query: 182 QKGQIVKLKDGRIFNGNDFCGPQRKGASFVYCTDTMFAQTALKLANGADLLIHEATFSHE 241
QKGQIVKLKDGRIFNGNDFCGPQRKGASFVYCTDTMFAQTALKLANGADLLIHEATFSHE
Sbjct: 181 QKGQIVKLKDGRIFNGNDFCGPQRKGASFVYCTDTMFAQTALKLANGADLLIHEATFSHE 240

Query: 242 DSDLAYQRQHSTSTMAAQIASEANVGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL 301
DSDLAYQRQHSTSTMAAQIASEANVGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL
Sbjct: 241 DSDLAYQRQHSTSTMAAQIASEANVGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL 300

Query: 302 LAKDFLQIEIQK 313
LAKDFLQIEIQK
Sbjct: 301 LAKDFLQIEIQK 312