NC_004347
Chromosome NC_004347
Query gi|24371870
Alignment
>1di6A 3 157 1 160 1e-07
ref|NP_715912.1| competence/damage-inducible protein CinA [Shewanella oneidensis
MR-1] gb|AAN53357.1| competence/damage-inducible protein
CinA [Shewanella oneidensis MR-1]
Length = 160



Score = 271 bits (1021), Expect = 4e-72
Identities = 160/160 (100%), Positives = 160/160 (100%)

Query: 1 MKLEMICTGEEVLSGQIVDTNAAWFASTMMEHGIEIQRRVTVGDRLEDLIAVFQERSLHA 60
MKLEMICTGEEVLSGQIVDTNAAWFASTMMEHGIEIQRRVTVGDRLEDLIAVFQERSLHA
Sbjct: 1 MKLEMICTGEEVLSGQIVDTNAAWFASTMMEHGIEIQRRVTVGDRLEDLIAVFQERSLHA 60

Query: 61 DVILVNGGLGPTSDDMSAEAMAKAKGESLVENSEWRQRLEDWFTRNNREMPVSNLKQAML 120
DVILVNGGLGPTSDDMSAEAMAKAKGESLVENSEWRQRLEDWFTRNNREMPVSNLKQAML
Sbjct: 61 DVILVNGGLGPTSDDMSAEAMAKAKGESLVENSEWRQRLEDWFTRNNREMPVSNLKQAML 120

Query: 121 PVSAVMVDNPVGTACGFRVKLNRAWLFFTPGVPFELKHMV 160
PVSAVMVDNPVGTACGFRVKLNRAWLFFTPGVPFELKHMV
Sbjct: 121 PVSAVMVDNPVGTACGFRVKLNRAWLFFTPGVPFELKHMV 160