NC_005861
Chromosome NC_005861
Query gi|46445650
Alignment
>1jv1A 10 430 2 398 4e-89
ref|YP_007015.1| putative bifunctional protein UDP-N-acetylglucosamine
pyrophosphorylases, Glucosamine-1-phosphate
N-acetyltransferase [Parachlamydia sp. UWE25]
emb|CAF22740.1| putative bifunctional protein
UDP-N-acetylglucosamine pyrophosphorylases,
Glucosamine-1-phosphate N-acetyltransferase
[Parachlamydia sp. UWE25]
Length = 397



Score = 623 bits (2367), Expect = e-178
Identities = 378/397 (95%), Positives = 378/397 (95%)

Query: 2 LAKKANDPLLKFWTLLSKQEQQNLTLQIKQINRTLLDQQIALINPSKSVDSFIEPFKDYA 61
LAKKANDPLLKFWTLLSKQEQQNLTLQIKQINRTLLDQQIALINPSKSVDSFIEPFKDYA
Sbjct: 1 LAKKANDPLLKFWTLLSKQEQQNLTLQIKQINRTLLDQQIALINPSKSVDSFIEPFKDYA 60

Query: 62 FAXXXXXXXXXXXXXXXXXXXCIVLAGGQGTRLCFEGPKGLFPVSVIKHKSLFQLLAEKT 121
FA CIVLAGGQGTRLCFEGPKGLFPVSVIKHKSLFQLLAEKT
Sbjct: 61 FAGNEKLQLKGKQLLQNGKMGCIVLAGGQGTRLCFEGPKGLFPVSVIKHKSLFQLLAEKT 120

Query: 122 VAASKQVNFPLSLAIMTSPKNDQATKQFFVENDYWGLSKGQISFFCQSTLPLLNAEGSLF 181
VAASKQVNFPLSLAIMTSPKNDQATKQFFVENDYWGLSKGQISFFCQSTLPLLNAEGSLF
Sbjct: 121 VAASKQVNFPLSLAIMTSPKNDQATKQFFVENDYWGLSKGQISFFCQSTLPLLNAEGSLF 180

Query: 182 LETKSRIAEGPNGNGHCLHDFYQSGLYDVWKQRGIEYINIILVDNPLADPFDAELLGFHH 241
LETKSRIAEGPNGNGHCLHDFYQSGLYDVWKQRGIEYINIILVDNPLADPFDAELLGFHH
Sbjct: 181 LETKSRIAEGPNGNGHCLHDFYQSGLYDVWKQRGIEYINIILVDNPLADPFDAELLGFHH 240

Query: 242 QQKAEITIKCTEKHEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQYCCANLS 301
QQKAEITIKCTEKHEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQYCCANLS
Sbjct: 241 QQKAEITIKCTEKHEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQYCCANLS 300

Query: 302 LFCFSMSFIENTLPNHPFLPLHKAWKAAKFVNEQGVTTLSSHPIAWKFETFIFDWLQYSK 361
LFCFSMSFIENTLPNHPFLPLHKAWKAAKFVNEQGVTTLSSHPIAWKFETFIFDWLQYSK
Sbjct: 301 LFCFSMSFIENTLPNHPFLPLHKAWKAAKFVNEQGVTTLSSHPIAWKFETFIFDWLQYSK 360

Query: 362 KVFALLYPRHHCFAPLKNFQGNDSLESVQKALIYREK 398
KVFALLYPRHHCFAPLKNFQGNDSLESVQKALIYREK
Sbjct: 361 KVFALLYPRHHCFAPLKNFQGNDSLESVQKALIYREK 397