| NC_006461 | |
| Chromosome | NC_006461 |
| Query | gi|55981657 |
| Alignment | >1fjgS 1 84 2 85 2e-32 ref|YP_005293.1| SSU ribosomal protein S19P [Thermus thermophilus HB27] ref|YP_144954.1| 30S ribosomal protein S19 [Thermus thermophilus HB8] emb|CAA58878.1| ribosomal protein S19 [Thermus thermophilus] sp|P62660|RS19_THET2 30S ribosomal protein S19 gb|AAS81666.1| SSU ribosomal protein S19P [Thermus thermophilus HB27] dbj|BAD71511.1| 30S ribosomal protein S19 [Thermus thermophilus HB8] pdb|1JGQ|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGP|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGO|V Chain V, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1ML5|V Chain V, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 sp|P80381|RS19_THETH 30S ribosomal protein S19 pdb|1XNR|S Chain S, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center pdb|1XNQ|S Chain S, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center pdb|1XMQ|S Chain S, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center pdb|1XMO|S Chain S, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center pdb|1HR0|S Chain S, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1FKA|S Chain S, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution pdb|1GIX|V Chain V, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1IBM|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBL|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1IBK|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1HNZ|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1HNX|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1HNW|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1FJG|S Chain S, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 84 Score = 129 bits (475), Expect = 1e-29 Identities = 84/84 (100%), Positives = 84/84 (100%) Query: 2 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY 61 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY Sbjct: 1 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY 60 Query: 62 ITENMVGHKLGEFAPTRTYRGHGK 85 ITENMVGHKLGEFAPTRTYRGHGK Sbjct: 61 ITENMVGHKLGEFAPTRTYRGHGK 84 |