EHA1
Chromosome EHA1
Query 40.m00228
Alignment
>1jw3A 4 140 3 133 3e-24
gb|EAL49542.1| conserved hypothetical protein [Entamoeba histolytica HM-1:IMSS]
Length = 131



Score = 194 bits (725), Expect = 2e-49
Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 3 FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF 62
FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF
Sbjct: 1 FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF 60

Query: 63 SSELFIGKSFKCEVFDDNDEENIHIECKGIGEYFVIGKHQQGTEIKAITWHNLEIYDDEK 122
SSELFIGKSFKCEVFDDNDEENIHIECKGIGEYFVIGKHQQGTEIKAITWHNLEIYDDEK
Sbjct: 61 SSELFIGKSFKCEVFDDNDEENIHIECKGIGEYFVIGKHQQGTEIKAITWHNLEIYDDEK 120

Query: 123 DQTHIHILLDI 133
DQTHIHILLDI
Sbjct: 121 DQTHIHILLDI 131