EHA1
Chromosome EHA1
Query 111.m00134
Alignment
>1t5oA 62 339 248 496 4e-29
gb|EAL47236.1| Initiation factor eIF-2B delta subunit, putative [Entamoeba
histolytica HM-1:IMSS]
Length = 249



Score = 352 bits (1330), Expect = 3e-96
Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 248 KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307
KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI
Sbjct: 1 KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 60

Query: 308 IGSQKEIVSSKINEKIVVDSYKYVNDGSVILTINYSTLLLNVFKTAFTDTNKFRVIVVET 367
IGSQKEIVSSKINEKIVVDSYKYVNDGSVILTINYSTLLLNVFKTAFTDTNKFRVIVVET
Sbjct: 61 IGSQKEIVSSKINEKIVVDSYKYVNDGSVILTINYSTLLLNVFKTAFTDTNKFRVIVVET 120

Query: 368 SPFEEGAIFARALSEIGIDTTYILPSGLQVVLASVNRVILSASSMDGRGSLYTRSGTASV 427
SPFEEGAIFARALSEIGIDTTYILPSGLQVVLASVNRVILSASSMDGRGSLYTRSGTASV
Sbjct: 121 SPFEEGAIFARALSEIGIDTTYILPSGLQVVLASVNRVILSASSMDGRGSLYTRSGTASV 180

Query: 428 LIAAKSKHIPVIVCCETYKMTDEIMKNEGEICRIGNGITLYDEIPHDFITVVVTEFGCIP 487
LIAAKSKHIPVIVCCETYKMTDEIMKNEGEICRIGNGITLYDEIPHDFITVVVTEFGCIP
Sbjct: 181 LIAAKSKHIPVIVCCETYKMTDEIMKNEGEICRIGNGITLYDEIPHDFITVVVTEFGCIP 240

Query: 488 ATSIPAVVR 496
ATSIPAVVR
Sbjct: 241 ATSIPAVVR 249