EHA1
Chromosome EHA1
Query 231.m00060
Alignment
>1qb0A 24 176 94 234 7e-28
gb|EAL44886.1| protein phosphatase, putative [Entamoeba histolytica HM-1:IMSS]
Length = 141



Score = 220 bits (823), Expect = 8e-57
Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 94 GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI 153
GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI
Sbjct: 1 GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI 60

Query: 154 NYSKKIILIAYCEFSKTRAPNLLKELRHTIRNKLIDIFLVEGGYERIFEEFPSLCEGGYV 213
NYSKKIILIAYCEFSKTRAPNLLKELRHTIRNKLIDIFLVEGGYERIFEEFPSLCEGGYV
Sbjct: 61 NYSKKIILIAYCEFSKTRAPNLLKELRHTIRNKLIDIFLVEGGYERIFEEFPSLCEGGYV 120

Query: 214 QMNDPQYFDEFIYYSKIHSQS 234
QMNDPQYFDEFIYYSKIHSQS
Sbjct: 121 QMNDPQYFDEFIYYSKIHSQS 141