NC_003306
Chromosome NC_003306
Query gi|17938822
Alignment
>1pb7A 14 286 8 254 6e-14
ref|NP_396167.1| hypothetical protein AGR_pAT_333 [Agrobacterium tumefaciens str.
C58] ref|NP_535610.1| ABC transporter, substrate binding
protein [amino acid] [Agrobacterium tumefaciens str.
C58] gb|AAL45926.1| ABC transporter, substrate binding
protein [amino acid] [Agrobacterium tumefaciens str.
C58] gb|AAK90608.1| AGR_pAT_333p [Agrobacterium
tumefaciens str. C58] pir||AH3188 hypothetical protein
Atu5237 [imported] - Agrobacterium tumefaciens (strain
C58, Dupont) plasmid AT
Length = 247



Score = 354 bits (1337), Expect = 3e-97
Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 28 DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 87
DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS
Sbjct: 21 DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80

Query: 88 LLADKVDVLIAAAGATPERAQQVMFSQPYAAVSLGVFGGDGEKIDDVSGLAGKQIAVAKG 147
LLADKVDVLIAAAGATPERAQQVMFSQPYAAVSLGVFGGDGEKIDDVSGLAGKQIAVAKG
Sbjct: 81 LLADKVDVLIAAAGATPERAQQVMFSQPYAAVSLGVFGGDGEKIDDVSGLAGKQIAVAKG 140

Query: 148 STLDTWLTDNAPEVKLVRFEDTPSAIAAFLAGQADYFAENSAIAVKVADDNPGKNVAIVY 207
STLDTWLTDNAPEVKLVRFEDTPSAIAAFLAGQADYFAENSAIAVKVADDNPGKNVAIVY
Sbjct: 141 STLDTWLTDNAPEVKLVRFEDTPSAIAAFLAGQADYFAENSAIAVKVADDNPGKNVAIVY 200

Query: 208 RIRLSPAHVGVKQGEQNFLNWINTFLFFHNMNGDLAKLQMTFFKEKQ 254
RIRLSPAHVGVKQGEQNFLNWINTFLFFHNMNGDLAKLQMTFFKEKQ
Sbjct: 201 RIRLSPAHVGVKQGEQNFLNWINTFLFFHNMNGDLAKLQMTFFKEKQ 247