NC_002928
Chromosome NC_002928
Query gi|33595634
Alignment
>1wkqA 2 152 15 167 2e-28
ref|NP_881465.1| hypothetical protein BP2880 [Bordetella pertussis Tohama I]
emb|CAE43152.1| conserved hypothetical protein
[Bordetella pertussis Tohama I]
Length = 153



Score = 149 bits (554), Expect = 5e-36
Identities = 100/127 (78%), Positives = 100/127 (78%)

Query: 41 LVAKDGVVLARGVNRMLADHDPTAHXXXXXXXXXXXXXXXXXXDGCVVYASGQPCPMCLA 100
LVAKDGVVLARGVNRMLADHDPTAH DGCVVYASGQPCPMCLA
Sbjct: 27 LVAKDGVVLARGVNRMLADHDPTAHTELLALREAGRALRSARLDGCVVYASGQPCPMCLA 86

Query: 101 AMRMSGVARAVYAYSNEQAEPYGLSTXXXXXXXXXPPQRQPGFAFEHRPGAAAPDADLYR 160
AMRMSGVARAVYAYSNEQAEPYGLST PPQRQPGFAFEHRPGAAAPDADLYR
Sbjct: 87 AMRMSGVARAVYAYSNEQAEPYGLSTAALAVELALPPQRQPGFAFEHRPGAAAPDADLYR 146

Query: 161 EWQDGPQ 167
EWQDGPQ
Sbjct: 147 EWQDGPQ 153