NC_000913
Chromosome NC_000913
Query gi|16131153
Alignment
>1vf7E 2 252 48 311 1e-69
gb|AAG58393.1| transmembrane protein affects septum formation and cell membrane
permeability [Escherichia coli O157:H7 EDL933]
pir||E85991 hypothetical protein acrE [imported] -
Escherichia coli (strain O157:H7, substrain EDL933)
dbj|BAB37560.1| transmembrane protein affects septum
formation and cell membrane permeability [Escherichia
coli O157:H7] pir||A91146 hypothetical protein ECs4137
[imported] - Escherichia coli (strain O157:H7, substrain
RIMD 0509952) ref|NP_312164.1| transmembrane protein
affects septum formation and cell membrane permeability
[Escherichia coli O157:H7] ref|NP_289833.1|
transmembrane protein affects septum formation and cell
membrane permeability [Escherichia coli O157:H7 EDL933]
Length = 264



Score = 336 bits (1269), Expect = 1e-91
Identities = 229/264 (86%), Positives = 229/264 (86%)

Query: 48 PLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYDXX 107
PLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYD
Sbjct: 1 PLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYDSA 60

Query: 108 XXXXXXXXXXXXXXHLTVKRYVPLVGTKYISQQEYXXXXXXXXXXXXXXXXXXXTVESAR 167
HLTVKRYVPLVGTKYISQQEY TVESAR
Sbjct: 61 KGELAKSEAAAAIAHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATVESAR 120

Query: 168 INLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQ 227
INLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQ
Sbjct: 121 INLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQ 180

Query: 228 SVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLL 287
SVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLL
Sbjct: 181 SVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLL 240

Query: 288 PGMFVRARIDEGVQPDAILIPQQG 311
PGMFVRARIDEGVQPDAILIPQQG
Sbjct: 241 PGMFVRARIDEGVQPDAILIPQQG 264