407521
Sequence ID 407521
Sequence Collection ID 162
New Approach Non-TMB
SOSUI Non-TMH
Amino Acid Non-TMB
Dipeptide Non-TMB
Motif Non-TMB
SVM TMB
Header >gi|15829017|ref|NP_326377.1| DNA-DIRECTED RNA POLYMERASE BETA CHAIN (TRANSCRIPTASE BETA CHAIN) (RNA POLYMERASE BETA SUBUNIT) ||
Sequence
MPQKINYELKNFGQYTKRRDYSKTRFSLPLTDVLAIQKESFDWFLNKAIEATLRKYYPIK
SSNNKVEIKYVLGSKRIEKPLVTEQKAVKEAKQKGISYSARLYVKLQKHITETGEISFDE
VILCDIPLMTSSGSFIINGFEKVIVSQLIRSPGAYFAQKTRDKQSDDLFNKVEVLPRIGS
WIEIKHKVTSNLDSVKIKIDKHKSFLLTTFLSSFGFTEESMYKLFGNSETLKNTLSKDKI
LGKNKDIVEIRKEAQENIFRIVRRGDRITKEASQNLISNLLFNEKRYNLSKTGRYMLNRK
LSLFDRIITTYLAQDIVLKNVDPTMEAKILYPKGTYITNDIAIEIQNAFKEGLIKNIDLK
DYGITSDVYGKLLDTNPKLKNRMNIIGIYIFKSKKAMEKDGEKHFVIGNDPTSVENHLLI
SDIVAIINYYFNLNENIGRDDDPDSLINKRIVSVGELLLNQLNIGLLKMEKNTREKMSSK
EISRITPKNITNNKMIQNQIKTFFNSSKLSQFMDQTNPLSEISTKRKITSLGPGGLNRDT
AQFEVRDVHATHYGRICPIETPEGPNIGLILNLATYAKVDEYGFLQTPYFKVTNGIVDFS
QPVYLTAHEEINRTFAQSSISIDENGKITDEQVIVKSNFDYNVVSPKEVDYIDVSSKQMT
SLAASSIPFLENNDANRALMGSNMQRQAVPLLFAEAPLVATGIEADIAKFSPNNLKSTVD
GEVVFVDGSQIKIKDSASEKGSIKTYQLKTFEKTNQGTVISQSPIVKMGDKVLKGDLISD
SSSFKDGEMALGKNVLVGFSTWNGYNYEDAIIVSERLVKDDVFTSIHIEEQTIQFRKSKA
GDDKLTADIPNASLKSRRHLDENGIVRIGSEVVTGDILVGRVSPKGDENISPAEKLLNGI
FNQKISNEKDTSLKVKNGHQGTVIDVEILSRENGNVLEEEIDMMIKVYVAQKRKIKVGDK
MAGRHGNKGVISRVLPVEDMPYLEDGTPLDIILNPQGVPSRMNIGQVLELHLGMAAKKLG
VKFVSPVFDGVKKADIMDALEEAKLPRTGKMKVFDPTTGEKIDNEISVGVMYMFKLSHMV
DDKMHSRSIGPYSLITQQPLGGKSQNGGQRFGEMETWALESYGAANILQEILTYKSDDIQ
GRNNLYSALTSGTKLPKPGVPESFSVLAYELRGLGIKLQIHEKEEEKQELPSQEYESLNL
DQELKTASENVSESEF