NC_004741 | |
Chromosome | NC_004741 |
Query | gi|30064564 |
Alignment | >1j3aA 3 117 17 142 5e-24 ref|NP_709028.2| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 301] gb|AAN44735.2| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 301] ref|YP_152348.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150] ref|NP_806936.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi Ty2] ref|NP_838735.1| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 2457T] ref|NP_457722.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gb|AAV79036.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gb|AAL22214.1| 50S ribosomal subunit protein L13 [Salmonella typhimurium LT2] gb|AAP18546.1| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 2457T] gb|AAO70796.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi Ty2] emb|CAA26041.1| unnamed protein product [Escherichia coli] ref|NP_417698.1| 50S ribosomal subunit protein L13 [Escherichia coli K12] gb|AAC76263.1| 50S ribosomal subunit protein L13 [Escherichia coli K12] emb|CAD07861.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi] gb|AAA58033.1| 50S ribosomal subunit protein L13 [Escherichia coli] pir||R5EC13 ribosomal protein L13 [validated] - Escherichia coli (strain K-12) gb|AAG58359.1| 50S ribosomal subunit protein L13 [Escherichia coli O157:H7 EDL933] dbj|BAB37527.1| 50S ribosomal subunit protein L13 [Escherichia coli O157:H7] pir||AG0908 ribosomal protein L13 [similarity] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) pir||H91141 ribosomal protein L13 [similarity] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||C85987 ribosomal protein L13 [similarity] - Escherichia coli (strain O157:H7, substrain EDL933) ref|NP_462255.1| 50S ribosomal subunit protein L13 [Salmonella typhimurium LT2] ref|NP_312131.1| 50S ribosomal subunit protein L13 [Escherichia coli O157:H7] pdb|1P86|H Chain H, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome pdb|1P85|H Chain H, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome sp|P02410|RL13_ECOLI 50S ribosomal protein L13 ref|NP_289799.1| 50S ribosomal subunit protein L13 [Escherichia coli O157:H7 EDL933] Length = 126 Score = 191 bits (713), Expect = 2e-48 Identities = 126/126 (100%), Positives = 126/126 (100%) Query: 17 VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYH 76 VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYH Sbjct: 1 VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYH 60 Query: 77 HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQ 136 HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQ Sbjct: 61 HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQ 120 Query: 137 PQVLDI 142 PQVLDI Sbjct: 121 PQVLDI 126 |