NC_006155 | |
Chromosome | NC_006155 |
Query | gi|51596546 |
Alignment | >1omiA 6 215 40 244 4e-36 ref|NP_669443.1| transcriptional regulation of aerobic, anaerobic respiration and osmotic balance [Yersinia pestis KIM] gb|AAS62296.1| fumarate and nitrate reduction regulatory protein [Yersinia pestis biovar Medievalis str. 91001] ref|NP_993419.1| fumarate and nitrate reduction regulatory protein [Yersinia pestis biovar Medievalis str. 91001] gb|AAM85694.1| transcriptional regulation of aerobic, anaerobic respiration and osmotic balance [Yersinia pestis KIM] emb|CAC91105.1| fumarate and nitrate reduction regulatory protein [Yersinia pestis CO92] ref|NP_405837.1| fumarate and nitrate reduction regulatory protein [Yersinia pestis CO92] pir||AE0280 fumarate and nitrate reduction regulatory protein fnr [imported] - Yersinia pestis (strain CO92) sp|Q8ZE82|FNR_YERPE Fumarate and nitrate reduction regulatory protein Length = 205 Score = 325 bits (1227), Expect = 1e-88 Identities = 205/205 (100%), Positives = 205/205 (100%) Query: 40 DQLDNIIERKKPIQKGQALFKAGDELKSLYAIRSGTIKSYTITEEGDEQITGFHLAGDLV 99 DQLDNIIERKKPIQKGQALFKAGDELKSLYAIRSGTIKSYTITEEGDEQITGFHLAGDLV Sbjct: 1 DQLDNIIERKKPIQKGQALFKAGDELKSLYAIRSGTIKSYTITEEGDEQITGFHLAGDLV 60 Query: 100 GFDAISNLQHPSFAQALETSMVCEIPFDTLDDLSGKMPNLRQQIMRLMSGEIKGDQDMIL 159 GFDAISNLQHPSFAQALETSMVCEIPFDTLDDLSGKMPNLRQQIMRLMSGEIKGDQDMIL Sbjct: 61 GFDAISNLQHPSFAQALETSMVCEIPFDTLDDLSGKMPNLRQQIMRLMSGEIKGDQDMIL 120 Query: 160 LLSKKNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 LLSKKNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ Sbjct: 121 LLSKKNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 180 Query: 220 KSNILSVKGKYITIENNEALAQLAG 244 KSNILSVKGKYITIENNEALAQLAG Sbjct: 181 KSNILSVKGKYITIENNEALAQLAG 205 |