NC_002655 | |
Chromosome | NC_002655 |
Query | gi|15803814 |
Alignment | >1xeoA 1 165 1 165 2e-58 pdb|1LRU|C Chain C, Crystal Structure Of E.Coli Peptide Deformylase Complexed With Antibiotic Actinonin pdb|1LRU|B Chain B, Crystal Structure Of E.Coli Peptide Deformylase Complexed With Antibiotic Actinonin pdb|1LRU|A Chain A, Crystal Structure Of E.Coli Peptide Deformylase Complexed With Antibiotic Actinonin pdb|1G2A|C Chain C, The Crystal Structure Of E.Coli Peptide Deformylase Complexed With Actinonin pdb|1G2A|B Chain B, The Crystal Structure Of E.Coli Peptide Deformylase Complexed With Actinonin pdb|1G2A|A Chain A, The Crystal Structure Of E.Coli Peptide Deformylase Complexed With Actinonin pdb|1G27|C Chain C, Crystal Structure Of E.Coli Polypeptide Deformylase Complexed With The Inhibitor Bb-3497 pdb|1G27|B Chain B, Crystal Structure Of E.Coli Polypeptide Deformylase Complexed With The Inhibitor Bb-3497 pdb|1G27|A Chain A, Crystal Structure Of E.Coli Polypeptide Deformylase Complexed With The Inhibitor Bb-3497 pdb|1BSK|A Chain A, Zinc Deformylase Inhibitor Complex From E.Coli pdb|1BSJ|A Chain A, Cobalt Deformylase Inhibitor Complex From E.Coli pdb|1BSZ|C Chain C, Peptide Deformylase As Fe2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1BSZ|B Chain B, Peptide Deformylase As Fe2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1BSZ|A Chain A, Peptide Deformylase As Fe2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1BS8|C Chain C, Peptide Deformylase As Zn2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS8|B Chain B, Peptide Deformylase As Zn2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS8|A Chain A, Peptide Deformylase As Zn2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS7|C Chain C, Peptide Deformylase As Ni2+ Containing Form pdb|1BS7|B Chain B, Peptide Deformylase As Ni2+ Containing Form pdb|1BS7|A Chain A, Peptide Deformylase As Ni2+ Containing Form pdb|1BS6|C Chain C, Peptide Deformylase As Ni2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS6|B Chain B, Peptide Deformylase As Ni2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS6|A Chain A, Peptide Deformylase As Ni2+ Containing Form In Complex With Tripeptide Met-Ala-Ser pdb|1BS5|C Chain C, Peptide Deformylase As Zn2+ Containing Form pdb|1BS5|B Chain B, Peptide Deformylase As Zn2+ Containing Form pdb|1BS5|A Chain A, Peptide Deformylase As Zn2+ Containing Form pdb|1BS4|C Chain C, Peptide Deformylase As Zn2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1BS4|B Chain B, Peptide Deformylase As Zn2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1BS4|A Chain A, Peptide Deformylase As Zn2+ Containing Form (Native) In Complex With Inhibitor Polyethylene Glycol pdb|1ICJ|C Chain C, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) pdb|1ICJ|B Chain B, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) Length = 165 Score = 225 bits (842), Expect = 1e-58 Identities = 165/165 (100%), Positives = 165/165 (100%) Query: 2 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVI 61 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVI Sbjct: 1 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVI 60 Query: 62 DVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL 121 DVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL Sbjct: 61 DVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL 120 Query: 122 EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166 EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK Sbjct: 121 EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 165 |