NC_002655 | |
Chromosome | NC_002655 |
Query | gi|15803845 |
Alignment | >1jj2R 3 80 9 98 4e-11 ref|NP_709106.1| 50S ribosomal subunit protein L23 [Shigella flexneri 2a str. 301] gb|AAN44813.1| 50S ribosomal subunit protein L23 [Shigella flexneri 2a str. 301] ref|NP_839552.1| 50S ribosomal subunit protein L23 [Shigella flexneri 2a str. 2457T] ref|NP_755951.1| 50S ribosomal protein L23 [Escherichia coli CFT073] gb|AAP19363.1| 50S ribosomal subunit protein L23 [Shigella flexneri 2a str. 2457T] emb|CAA26462.1| unnamed protein product [Escherichia coli] gb|AAN82525.1| 50S ribosomal protein L23 [Escherichia coli CFT073] ref|NP_417777.1| 50S ribosomal subunit protein L23 [Escherichia coli K12] gb|AAC76343.1| 50S ribosomal subunit protein L23 [Escherichia coli K12] gb|AAA58115.1| 50S ribosomal subunit protein L23 [Escherichia coli] pir||R5EC23 ribosomal protein L23 [validated] - Escherichia coli (strain K-12) gb|AAG58439.1| 50S ribosomal subunit protein L23 [Escherichia coli O157:H7 EDL933] dbj|BAB37606.1| 50S ribosomal subunit protein L23 [Escherichia coli O157:H7] pir||C85997 50S ribosomal subunit protein L23 [imported] - Escherichia coli (strain O157:H7, substrain EDL933) pir||G91151 50S ribosomal subunit protein L23 [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) ref|NP_312210.1| 50S ribosomal subunit protein L23 [Escherichia coli O157:H7] pdb|1P86|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome pdb|1P85|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome sp|P02424|RL23_ECOLI 50S ribosomal protein L23 ref|NP_289879.1| 50S ribosomal subunit protein L23 [Escherichia coli O157:H7 EDL933] Length = 90 Score = 92.3 bits (333), Expect = 2e-18 Identities = 73/90 (81%), Positives = 73/90 (81%) Query: 9 KVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKAAVQKLFXXXXXXXXXXXXXXXXX 68 KVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKAAVQKLF Sbjct: 1 KVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKAAVQKLFEVEVEVVNTLVVKGKVK 60 Query: 69 RHGQRIGRRSDWKKAYVTLKEGQNLDFVGG 98 RHGQRIGRRSDWKKAYVTLKEGQNLDFVGG Sbjct: 61 RHGQRIGRRSDWKKAYVTLKEGQNLDFVGG 90 |