NC_004337 | |
Chromosome | NC_004337 |
Query | gi|56480614 |
Alignment | >1kgsA 3 221 5 232 2e-34 ref|NP_710139.2| negative response regulator of genes in aerobic pathways (sensors, ArcB and CpxA) [Shigella flexneri 2a str. 301] gb|AAN45846.2| negative response regulator of genes in aerobic pathways (sensors, ArcB and CpxA) [Shigella flexneri 2a str. 301] ref|NP_839808.1| negative response regulator of genes in aerobic pathways (sensors, ArcB and CpxA) [Shigella flexneri 2a str. 2457T] ref|NP_757334.1| Aerobic respiration control protein arcA [Escherichia coli CFT073] gb|AAP19620.1| negative response regulator of genes in aerobic pathways (sensors, ArcB and CpxA) [Shigella flexneri 2a str. 2457T] gb|AAN83908.1| Aerobic respiration control protein arcA [Escherichia coli CFT073] ref|NP_418818.1| negative response regulator of genes in aerobic pathways, (sensors, ArcB and CpxA) [Escherichia coli K12] gb|AAC77354.1| negative response regulator of genes in aerobic pathways, (sensors, ArcB and CpxA); response regulator in two-component regulatory system with ArcB (or CpxA), regulates respiratory and fermentative metabolism (OmpR family) [Escherichia coli K12] gb|AAA97297.1| alternate gene names arcA, fexA, msp, seg, sfrA; CG Site No. 831 [Escherichia coli] pir||JYECR dye resistance protein - Escherichia coli (strain K-12) gb|AAG59581.1| negative response regulator of genes in aerobic pathways, (sensors, ArcB and CpxA) [Escherichia coli O157:H7 EDL933] dbj|BAB38782.1| negative response regulator of genes in aerobic pathways ArcA [Escherichia coli O157:H7] pir||A86140 dye resistance protein arcA [similarity] - Escherichia coli (strain O157:H7, substrain EDL933) pir||G91298 dye resistance protein arcA [similarity] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) ref|NP_313386.1| ArcA [Escherichia coli O157:H7] sp|P03026|ARCA_ECOLI Aerobic respiration control protein arcA (Dye resistance protein) ref|NP_291014.1| negative response regulator of genes in aerobic pathways, (sensors, ArcB and CpxA) [Escherichia coli O157:H7 EDL933] gb|AAA23718.1| dye Length = 228 Score = 357 bits (1350), Expect = 3e-98 Identities = 228/228 (100%), Positives = 228/228 (100%) Query: 5 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLL 64 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLL Sbjct: 1 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLL 60 Query: 65 LARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRTMNL 124 LARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRTMNL Sbjct: 61 LARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRTMNL 120 Query: 125 GTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAE 184 GTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAE Sbjct: 121 GTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAE 180 Query: 185 LLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRF 232 LLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRF Sbjct: 181 LLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRF 228 |