NC_000853 | |
Chromosome | NC_000853 |
Query | gi|15644405 |
Alignment | >1fjgT 1 99 8 106 3e-15 ref|YP_144663.1| 30S ribosomal protein S20 [Thermus thermophilus HB8] emb|CAC15067.1| ribosomal protein S20 [Thermus thermophilus] dbj|BAD71220.1| 30S ribosomal protein S20 [Thermus thermophilus HB8] sp|P80380|RS20_THETH 30S ribosomal protein S20 pdb|1N36|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position pdb|1N34|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position pdb|1N33|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin pdb|1N32|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin pdb|1XNR|T Chain T, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center pdb|1XNQ|T Chain T, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center pdb|1XMQ|T Chain T, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center pdb|1XMO|T Chain T, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center pdb|1IBM|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBL|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1IBK|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin Length = 99 Score = 33.3 bits (107), Expect = 1.0 Identities = 38/83 (45%), Positives = 52/83 (61%), Gaps = 1/83 (1%) Query: 6 SAKKRVRVSEKRRLRNKAYKTFFKNRIKEVLKAIENKEPKEVVLELTRKAQAAIDKAVSK 65 SA KR R S KRRLRNKA K+ K K+ ++ + + +E L++ RKA++ IDKA Sbjct: 4 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEE-ALKIMRKAESLIDKAAKG 62 Query: 66 GVIHKNQGARRKARLFEKVNEYL 88 +HKN ARRK+RL KV + L Sbjct: 63 STLHKNAAARRKSRLMRKVRQLL 85 |