NC_003028 | |
Chromosome | NC_003028 |
Query | gi|15900440 |
Alignment | >1jbeA 9 123 8 119 2e-18 pdb|1KRX|A Chain A, Solution Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structures Incorporating Active Site Contacts pdb|1KRW|A Chain A, Solution Structure And Backbone Dynamics Of Beryllofluoride- Activated Ntrc Receiver Domain pdb|1J56|A Chain A, Minimized Average Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structure Incorporating Active Site Contacts pdb|1NTR| Solution Structure Of The N-Terminal Receiver Domain Of Ntrc Length = 112 Score = 40.1 bits (133), Expect = 0.013 Identities = 33/122 (27%), Positives = 62/122 (50%), Gaps = 10/122 (8%) Query: 5 VLEDDFSQQTRIETTIEKLLKAHHIIPSSFEVFGKPDQLLAEVHEKGAHQLFFLDIEIRN 64 V++DD S I +E+ L + ++FE +++LA + K L+ +IR Sbjct: 1 VVDDDSS----IRWVLERALAGAGLTCTTFE---NGNEVLAALASKTPDVLLS---DIRM 50 Query: 65 EEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQVSALDYIDKALSAEEFESRIET 124 M GL + ++I+ R P ++ +T HS++ YQ A+DY+ K + +E + +E Sbjct: 51 PGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVER 110 Query: 125 AL 126 A+ Sbjct: 111 AI 112 |