NC_006350 | |
Chromosome | NC_006350 |
Query | gi|53720413 |
Alignment | >1b0uA 2 257 3 248 2e-54 ref|NP_344170.1| ABC transporter, ATP binding protein (glucose) [Sulfolobus solfataricus P2] gb|AAK42960.1| ABC transporter, ATP binding protein (glucose) [Sulfolobus solfataricus P2] pdb|1OXV|D Chain D, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXV|B Chain B, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXV|A Chain A, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXU|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXU|B Chain B, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXU|A Chain A, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXT|D Chain D, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXT|B Chain B, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXT|A Chain A, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus pir||A90463 ABC transporter, ATP binding protein (glucose) SSO2850 [imported] - Sulfolobus solfataricus Length = 246 Score = 76.6 bits (273), Expect = 9e-14 Identities = 66/216 (30%), Positives = 110/216 (50%), Gaps = 20/216 (9%) Query: 14 KSGERTVLDGVDVDIASGEKIGILGGNGAGKSTLIRIISGAERPTEGRVY--------RG 65 K G+ LD V+++I +GE+ GILG +GAGK+T++RII+G + P+ G +Y G Sbjct: 12 KKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNG 71 Query: 66 MSVSWP--LAFGGAFQT-----SLTGIDNLRFICRIYDVSVED---KLPFVREFTELGRY 115 + P G FQT +LT +N+ F +S E+ ++ V + ++ Sbjct: 72 KLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV 131 Query: 116 LNEPVKTYSAGMRAKLAFAISMAVDFDCFLIDEVTAVGDERFRQ--KCHVELFEKRNSRA 173 LN + S G + ++A+A ++ D +L+DE + D R R + V+ + R Sbjct: 132 LNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVT 191 Query: 174 MIFVSHDPGFIRANCQRATVLHGGKLYEFPEMDEAY 209 ++ VSHDP I A R VL GKL + + ++ Y Sbjct: 192 LLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLY 227 |