NC_000962 | |
Chromosome | NC_000962 |
Query | gi|15609375 |
Alignment | >1xvqA 16 164 1 153 2e-23 ref|NP_216754.1| Probable peroxiredoxin AhpE [Mycobacterium tuberculosis H37Rv] ref|NP_855911.1| peroxiredoxin AhpE [Mycobacterium bovis AF2122/97] emb|CAA94659.1| Probable peroxiredoxin AhpE [Mycobacterium tuberculosis H37Rv] gb|AAK46582.1| AhpC/TSA family protein [Mycobacterium tuberculosis CDC1551] sp|P65689|Y2262_MYCBO Putative peroxiredoxin Mb2262c (Thioredoxin reductase) sp|P65688|Y2238_MYCTU Putative peroxiredoxin Rv2238c/MT2298 (Thioredoxin reductase) pdb|1XXU|D Chain D, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin pdb|1XXU|C Chain C, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin pdb|1XXU|B Chain B, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin pdb|1XXU|A Chain A, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin ref|NP_336768.1| AhpC/TSA family protein [Mycobacterium tuberculosis CDC1551] emb|CAD97115.1| peroxiredoxin AhpE [Mycobacterium bovis AF2122/97] Length = 153 Score = 256 bits (961), Expect = 5e-68 Identities = 153/153 (100%), Positives = 153/153 (100%) Query: 1 MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFE 60 MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFE Sbjct: 1 MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFE 60 Query: 61 NDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFV 120 NDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFV Sbjct: 61 NDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFV 120 Query: 121 VDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA 153 VDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA Sbjct: 121 VDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA 153 |