NC_006461
Chromosome NC_006461
Query gi|55980214
Alignment
>1cqmA 1 98 1 98 3e-29
ref|YP_005709.1| SSU ribosomal protein S6P [Thermus thermophilus HB27]
ref|YP_143511.1| 30S ribosomal protein S6 (TS9)
[Thermus thermophilus HB8] gb|AAF27295.1| ribosomal
protein S6 [Thermus thermophilus] gb|AAS82082.1| SSU
ribosomal protein S6P [Thermus thermophilus HB27]
dbj|BAD70068.1| 30S ribosomal protein S6 (TS9) [Thermus
thermophilus HB8] pir||S43389 ribosomal protein S6 -
Thermus sp pdb|1PNX|F Chain F, Crystal Structure Of The
Wild Type Ribosome From E. Coli, 30s Subunit Of 70s
Ribosome. This File, 1pnx, Contains Only Molecules Of
The 30s Ribosomal Subunit. The 50s Subunit Is In The
Pdb File 1pny. pdb|1PNS|F Chain F, Crystal Structure Of
A Streptomycin Dependent Ribosome From E. Coli, 30s
Subunit Of 70s Ribosome. This File, 1pns, Contains The
30s Subunit, Two Trnas, And One Mrna Molecule. The 50s
Ribosomal Subunit Is In File 1pnu. pdb|1JGQ|I Chain I,
The Path Of Messenger Rna Through The Ribosome. This
File, 1jgq, Contains The 30s Ribosome Subunit, Three
Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
The File 1giy pdb|1JGP|I Chain I, The Path Of Messenger
Rna Through The Ribosome. This File, 1jgp, Contains The
30s Ribosome Subunit, Three Trna, And Mrna Molecules.
50s Ribosome Subunit Is In The File 1giy pdb|1JGO|I
Chain I, The Path Of Messenger Rna Through The
Ribosome. This File, 1jgo, Contains The 30s Ribosome
Subunit, Three Trna, And Mrna Molecules. 50s Ribosome
Subunit Is In The File 1giy sp|P62666|RS6_THET2 30S
ribosomal protein S6 sp|P23370|RS6_THETH 30S ribosomal
protein S6 (TS9) pdb|1ML5|I Chain I, Structure Of The
E. Coli Ribosomal Termination Complex With Release
Factor 2 pdb|1N36|F Chain F, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In The Presence Of
Crystallographically Disordered Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
Second Codon Position pdb|1N34|F Chain F, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In The
Presence Of Codon And Crystallographically Disordered
Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The First Codon Position pdb|1N33|F Chain
F, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Bound To Codon And Near-Cognate Transfer Rna
Anticodon Stem-Loop Mismatched At The Second Codon
Position At The A Site With Paromomycin pdb|1N32|F
Chain F, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit Bound To Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
First Codon Position At The A Site With Paromomycin
pdb|1XNR|F Chain F, Crystal Structure Of An
Inosine-Cytosine Wobble Base Pair In The Context Of The
Decoding Center pdb|1XNQ|F Chain F, Structure Of An
Inosine-Adenine Wobble Base Pair Complex In The Context
Of The Decoding Center pdb|1XMQ|F Chain F, Crystal
Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
Decoding Center pdb|1XMO|F Chain F, Crystal Structure
Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In
The Decoding Center pdb|1HR0|F Chain F, Crystal
Structure Of Initiation Factor If1 Bound To The 30s
Ribosomal Subunit pdb|1J5E|F Chain F, Structure Of The
Thermus Thermophilus 30s Ribosomal Subunit pdb|1FKA|F
Chain F, Structure Of Functionally Activated Small
Ribosomal Subunit At 3.3 A Resolution pdb|1GIX|I Chain
I, Crystal Structure Of The Ribosome At 5.5 A
Resolution. This File, 1gix, Contains The 30s Ribosome
Subunit, Three Trna, And Mrna Molecules. 50s Ribosome
Subunit Is In The File 1giy pdb|1I97|F Chain F, Crystal
Structure Of The 30s Ribosomal Subunit From Thermus
Thermophilus In Complex With Tetracycline pdb|1I96|F
Chain F, Crystal Structure Of The 30s Ribosomal Subunit
From Thermus Thermophilus In Complex With The
Translation Initiation Factor If3 (C-Terminal Domain)
pdb|1I95|F Chain F, Crystal Structure Of The 30s
Ribosomal Subunit From Thermus Thermophilus In Complex
With Edeine pdb|1I94|F Chain F, Crystal Structures Of
The Small Ribosomal Subunit With Tetracycline, Edeine
And If3 pdb|1IBM|F Chain F, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With A
Messenger Rna Fragment And Cognate Transfer Rna
Anticodon Stem-Loop Bound At The A Site pdb|1IBL|F
Chain F, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In Complex With A Messenger Rna
Fragment And Cognate Transfer Rna Anticodon Stem-Loop
Bound At The A Site And With The Antibiotic Paromomycin
pdb|1IBK|F Chain F, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With The
Antibiotic Paromomycin pdb|1HNZ|F Chain F, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Hygromycin B pdb|1HNX|F Chain F, Structure
Of The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Pactamycin pdb|1HNW|F Chain F, Structure
Of The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Tetracycline pdb|1VOZ|F Chain F, Crystal
Structure Of Five 70s Ribosomes From Escherichia Coli
In Complex With Protein Y. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400. pdb|1VOX|F Chain F, Crystal Structure Of
Five 70s Ribosomes From Escherichia Coli In Complex
With Protein Y. This File Contains The 30s Subunit Of
One 70s Ribosome. The Entire Crystal Structure Contains
Five 70s Ribosomes And Is Described In Remark 400.
pdb|1VOV|F Chain F, Crystal Structure Of Five 70s
Ribosomes From Escherichia Coli In Complex With Protein
Y. This File Contains The 30s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Five
70s Ribosomes And Is Described In Remark 400.
pdb|1VOS|F Chain F, Crystal Structure Of Five 70s
Ribosomes From Escherichia Coli In Complex With Protein
Y. This File Contains The 30s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Five
70s Ribosomes And Is Described In Remark 400.
pdb|1VOQ|F Chain F, Crystal Structure Of Five 70s
Ribosomes From Escherichia Coli In Complex With Protein
Y. This File Contains The 30s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Five
70s Ribosomes And Is Described In Remark 400.
pdb|1FJG|F Chain F, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With The
Antibiotics Streptomycin, Spectinomycin, And
Paromomycin pdb|1RIS| Ribosomal Protein S6
Length = 98



Score = 131 bits (483), Expect = 3e-30
Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF 60
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF
Sbjct: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF 60

Query: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL 98
LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Sbjct: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL 98