NC_006461 | |
Chromosome | NC_006461 |
Query | gi|55980214 |
Alignment | >1cqmA 1 98 1 98 3e-29 ref|YP_005709.1| SSU ribosomal protein S6P [Thermus thermophilus HB27] ref|YP_143511.1| 30S ribosomal protein S6 (TS9) [Thermus thermophilus HB8] gb|AAF27295.1| ribosomal protein S6 [Thermus thermophilus] gb|AAS82082.1| SSU ribosomal protein S6P [Thermus thermophilus HB27] dbj|BAD70068.1| 30S ribosomal protein S6 (TS9) [Thermus thermophilus HB8] pir||S43389 ribosomal protein S6 - Thermus sp pdb|1PNX|F Chain F, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. pdb|1PNS|F Chain F, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. pdb|1JGQ|I Chain I, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGP|I Chain I, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGO|I Chain I, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy sp|P62666|RS6_THET2 30S ribosomal protein S6 sp|P23370|RS6_THETH 30S ribosomal protein S6 (TS9) pdb|1ML5|I Chain I, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 pdb|1N36|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position pdb|1N34|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position pdb|1N33|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin pdb|1N32|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin pdb|1XNR|F Chain F, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center pdb|1XNQ|F Chain F, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center pdb|1XMQ|F Chain F, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center pdb|1XMO|F Chain F, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center pdb|1HR0|F Chain F, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1J5E|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit pdb|1FKA|F Chain F, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution pdb|1GIX|I Chain I, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1I97|F Chain F, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline pdb|1I96|F Chain F, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) pdb|1I95|F Chain F, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine pdb|1I94|F Chain F, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 pdb|1IBM|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBL|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1IBK|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1HNZ|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1HNX|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1HNW|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1VOZ|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOX|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOV|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOS|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOQ|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1FJG|F Chain F, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin pdb|1RIS| Ribosomal Protein S6 Length = 98 Score = 131 bits (483), Expect = 3e-30 Identities = 98/98 (100%), Positives = 98/98 (100%) Query: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF 60 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF Sbjct: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF 60 Query: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL 98 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL Sbjct: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL 98 |