NC_006461
Chromosome NC_006461
Query gi|55981004
Alignment
>1fjgP 1 83 1 83 1e-25
ref|YP_004648.1| SSU ribosomal protein S16P [Thermus thermophilus HB27]
ref|YP_144301.1| 30S ribosomal protein S16 [Thermus
thermophilus HB8] gb|AAS81021.1| SSU ribosomal protein
S16P [Thermus thermophilus HB27] dbj|BAD70858.1| 30S
ribosomal protein S16 [Thermus thermophilus HB8]
sp|P80379|RS16_THETH 30S ribosomal protein S16
sp|P62238|RS16_THET2 30S ribosomal protein S16
pdb|1N36|P Chain P, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In The Presence Of
Crystallographically Disordered Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
Second Codon Position pdb|1N34|P Chain P, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In The
Presence Of Codon And Crystallographically Disordered
Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The First Codon Position pdb|1N33|P Chain
P, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Bound To Codon And Near-Cognate Transfer Rna
Anticodon Stem-Loop Mismatched At The Second Codon
Position At The A Site With Paromomycin pdb|1N32|P
Chain P, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit Bound To Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
First Codon Position At The A Site With Paromomycin
pdb|1XNR|P Chain P, Crystal Structure Of An
Inosine-Cytosine Wobble Base Pair In The Context Of The
Decoding Center pdb|1XNQ|P Chain P, Structure Of An
Inosine-Adenine Wobble Base Pair Complex In The Context
Of The Decoding Center pdb|1XMQ|P Chain P, Crystal
Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
Decoding Center pdb|1XMO|P Chain P, Crystal Structure
Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In
The Decoding Center pdb|1HR0|P Chain P, Crystal
Structure Of Initiation Factor If1 Bound To The 30s
Ribosomal Subunit pdb|1J5E|P Chain P, Structure Of The
Thermus Thermophilus 30s Ribosomal Subunit pdb|1I97|P
Chain P, Crystal Structure Of The 30s Ribosomal Subunit
From Thermus Thermophilus In Complex With Tetracycline
pdb|1I96|P Chain P, Crystal Structure Of The 30s
Ribosomal Subunit From Thermus Thermophilus In Complex
With The Translation Initiation Factor If3 (C-Terminal
Domain) pdb|1I95|P Chain P, Crystal Structure Of The
30s Ribosomal Subunit From Thermus Thermophilus In
Complex With Edeine pdb|1I94|P Chain P, Crystal
Structures Of The Small Ribosomal Subunit With
Tetracycline, Edeine And If3 pdb|1IBM|P Chain P,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With A Messenger Rna Fragment And
Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
Site pdb|1IBL|P Chain P, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With A
Messenger Rna Fragment And Cognate Transfer Rna
Anticodon Stem-Loop Bound At The A Site And With The
Antibiotic Paromomycin pdb|1IBK|P Chain P, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With The Antibiotic Paromomycin pdb|1HNZ|P
Chain P, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In Complex With Hygromycin B
pdb|1HNX|P Chain P, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With
Pactamycin pdb|1HNW|P Chain P, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With
Tetracycline pdb|1EMW|A Chain A, Solution Structure Of
The Ribosomal Protein S16 From Thermus Thermophilus
pdb|1FJG|P Chain P, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With The
Antibiotics Streptomycin, Spectinomycin, And
Paromomycin
Length = 83



Score = 117 bits (428), Expect = 6e-26
Identities = 83/83 (100%), Positives = 83/83 (100%)

Query: 1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL 60
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL
Sbjct: 1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL 60

Query: 61 SVGAQPTDTARRLLRQAGVFRQE 83
SVGAQPTDTARRLLRQAGVFRQE
Sbjct: 61 SVGAQPTDTARRLLRQAGVFRQE 83