NC_006461
Chromosome NC_006461
Query gi|55981648
Alignment
>1fjgN 1 60 1 60 2e-11
pdb|1PNX|N Chain N, Crystal Structure Of The Wild Type Ribosome From E.
Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx,
Contains Only Molecules Of The 30s Ribosomal Subunit.
The 50s Subunit Is In The Pdb File 1pny. pdb|1PNS|N
Chain N, Crystal Structure Of A Streptomycin Dependent
Ribosome From E. Coli, 30s Subunit Of 70s Ribosome.
This File, 1pns, Contains The 30s Subunit, Two Trnas,
And One Mrna Molecule. The 50s Ribosomal Subunit Is In
File 1pnu. pdb|1N36|N Chain N, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In The Presence Of
Crystallographically Disordered Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
Second Codon Position pdb|1N34|N Chain N, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In The
Presence Of Codon And Crystallographically Disordered
Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The First Codon Position pdb|1N33|N Chain
N, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Bound To Codon And Near-Cognate Transfer Rna
Anticodon Stem-Loop Mismatched At The Second Codon
Position At The A Site With Paromomycin pdb|1N32|N
Chain N, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit Bound To Codon And Near-Cognate
Transfer Rna Anticodon Stem-Loop Mismatched At The
First Codon Position At The A Site With Paromomycin
pdb|1J5E|N Chain N, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit pdb|1I97|N Chain N,
Crystal Structure Of The 30s Ribosomal Subunit From
Thermus Thermophilus In Complex With Tetracycline
pdb|1I96|N Chain N, Crystal Structure Of The 30s
Ribosomal Subunit From Thermus Thermophilus In Complex
With The Translation Initiation Factor If3 (C-Terminal
Domain) pdb|1I95|N Chain N, Crystal Structure Of The
30s Ribosomal Subunit From Thermus Thermophilus In
Complex With Edeine pdb|1I94|N Chain N, Crystal
Structures Of The Small Ribosomal Subunit With
Tetracycline, Edeine And If3 pdb|1VOZ|N Chain N,
Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Five 70s Ribosomes
And Is Described In Remark 400. pdb|1VOX|N Chain N,
Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Five 70s Ribosomes
And Is Described In Remark 400. pdb|1VOV|N Chain N,
Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Five 70s Ribosomes
And Is Described In Remark 400. pdb|1VOS|N Chain N,
Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Five 70s Ribosomes
And Is Described In Remark 400. pdb|1VOQ|N Chain N,
Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Five 70s Ribosomes
And Is Described In Remark 400
Length = 60



Score = 71.1 bits (252), Expect = 5e-12
Identities = 60/60 (100%), Positives = 60/60 (100%)

Query: 2 ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
Sbjct: 1 ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 60