NC_004631 | |
Chromosome | NC_004631 |
Query | gi|29140852 |
Alignment | >1uj8A 10 73 2 65 3e-21 ref|YP_149660.1| hypothetical protein SPA0329 [Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150] ref|NP_804194.1| hypothetical protein t0319 [Salmonella enterica subsp. enterica serovar Typhi Ty2] ref|NP_457068.1| hypothetical protein STY2783 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gb|AAV76348.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] ref|YP_217519.1| believed to be involved in assembly of Fe-S clusters [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gb|AAX66438.1| believed to be involved in assembly of Fe-S clusters [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gb|AAL21431.1| hypothetical protein [Salmonella typhimurium LT2] gb|AAO68043.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] emb|CAD02740.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] pir||AH0823 conserved hypothetical protein STY2783 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) ref|NP_461472.1| hypothetical protein STM2537 [Salmonella typhimurium LT2] Length = 64 Score = 89.9 bits (324), Expect = 1e-17 Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 2 GLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDDPNASNEKILEAILLVW 61 GLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDDPNASNEKILEAILLVW Sbjct: 1 GLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDDPNASNEKILEAILLVW 60 Query: 62 LDEA 65 LDEA Sbjct: 61 LDEA 64 |