NC_004631 | |
Chromosome | NC_004631 |
Query | gi|29142775 |
Alignment | >1jw2A 1 72 1 72 2e-20 ref|YP_151447.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150] ref|NP_806117.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] ref|NP_455070.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gb|AAV78135.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] ref|YP_215502.1| hemolysin expression modulating protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gb|AAX64421.1| hemolysin expression modulating protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gb|AAL19427.1| hemolysin expression modulating protein (involved in environmental regulation of virulence factors) [Salmonella typhimurium LT2] gb|AAO69977.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] emb|CAD04958.1| haemolysin expression modulating protein [Salmonella enterica subsp. enterica serovar Typhi] gb|AAF67181.1| Hha [Salmonella typhimurium] pir||AD0561 haemolysin expression modulating protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) ref|NP_459468.1| hemolysin expression-modulating protein [Salmonella typhimurium LT2] Length = 72 Score = 100 bits (366), Expect = 5e-21 Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY 60 MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY Sbjct: 1 MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY 60 Query: 61 DKIPSSVWKFIR 72 DKIPSSVWKFIR Sbjct: 61 DKIPSSVWKFIR 72 |