NC_003074
Chromosome NC_003074
Query gi|15231241
Alignment
>1ytbA 1 180 19 198 6e-66
gb|AAR28027.1| TBP1 [Arabidopsis thaliana] gb|AAK15570.1| putative TATA
sequence-binding transcription initiation factor protein
[Arabidopsis thaliana] gb|AAG42019.1| putative
transcription initiation factor TFIID-1 [Arabidopsis
thaliana] gb|AAM61444.1| transcription initiation factor
TFIID-1 (TATA sequence-binding protein 1) [Arabidopsis
thaliana] dbj|BAB01751.1| transcription initiation
factor TFIID-1 (TATA-box factor 1) (TATA
sequence-binding protein 1) (TBP-1) [Arabidopsis
thaliana] emb|CAA38743.1| transcription initiation
factor II [Arabidopsis thaliana] gb|AAL66870.1|
transcription initiation factor TFIID-1 [Arabidopsis
thaliana] gb|AAK96799.1| transcription initiation factor
TFIID-1 (TATA-box factor 1) (TATA sequence-binding
protein 1) (TBP-1) [Arabidopsis thaliana] gb|AAG40047.1|
AT3g13445 [Arabidopsis thaliana] ref|NP_187953.1|
transcription initiation factor IID-1 (TFIID-1) /
TATA-box factor 1 / TATA sequence-binding protein 1
(TBP1) [Arabidopsis thaliana] pir||S10946 transcription
initiation factor IID (clone At-2) - Arabidopsis
thaliana sp|P28147|TBP1_ARATH TATA-box binding protein 1
(TATA-box factor 1) (TATA binding factor 1) (TATA
sequence-binding protein 1) (TBP-1) (Transcription
initiation factor TFIID TBP-1 subunit) pdb|1QN4|B Chain
B, Crystal Structure Of The T(-24) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN4|A Chain A,
Crystal Structure Of The T(-24) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN3|B Chain B,
Crystal Structure Of The C(-25) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN3|A Chain A,
Crystal Structure Of The C(-25) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QNE|B Chain B,
Crystal Structure Of The Adenovirus Major Late Promoter
Tata Box Bound To Wild-Type Tbp (Arabidopsis Thaliana
Tbp Isoform 2). pdb|1QNE|A Chain A, Crystal Structure Of
The Adenovirus Major Late Promoter Tata Box Bound To
Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2).
pdb|1QNC|B Chain B, Crystal Structure Of The A(-31)
Adenovirus Major Late Promoter Tata Box Variant Bound To
Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata
Element Recognition By The Tata Box-Binding Protein Has
Been Conserved Throughout Evolution. pdb|1QNC|A Chain A,
Crystal Structure Of The A(-31) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QNB|B Chain B,
Crystal Structure Of The T(-25) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QNB|A Chain A,
Crystal Structure Of The T(-25) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QNA|B Chain B,
Crystal Structure Of The T(-30) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QNA|A Chain A,
Crystal Structure Of The T(-30) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN9|B Chain B,
Crystal Structure Of The C(-29) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN9|A Chain A,
Crystal Structure Of The C(-29) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN8|B Chain B,
Crystal Structure Of The T(-28) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN8|A Chain A,
Crystal Structure Of The T(-28) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN7|B Chain B,
Crystal Structure Of The T(-27) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN7|A Chain A,
Crystal Structure Of The T(-27) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN6|B Chain B,
Crystal Structure Of The T(-26) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN6|A Chain A,
Crystal Structure Of The T(-26) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN5|B Chain B,
Crystal Structure Of The G(-26) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1QN5|A Chain A,
Crystal Structure Of The G(-26) Adenovirus Major Late
Promoter Tata Box Variant Bound To Wild-Type Tbp
(Arabidopsis Thaliana Tbp Isoform 2). Tata Element
Recognition By The Tata Box-Binding Protein Has Been
Conserved Throughout Evolution. pdb|1VOL|B Chain B,
Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT
Ternary Complex pdb|1VOK|B Chain B, Arabidopsis Thaliana
Tbp (Dimer) pdb|1VOK|A Chain A, Arabidopsis Thaliana Tbp
(Dimer) prf||1613452B transcription initiation factor
TFIID-2
Length = 180



Score = 282 bits (1060), Expect = 1e-75
Identities = 180/180 (100%), Positives = 180/180 (100%)

Query: 19 SGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGK 78
SGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGK
Sbjct: 1 SGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGK 60

Query: 79 MVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHA 138
MVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHA
Sbjct: 61 MVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHA 120

Query: 139 AFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI 198
AFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Sbjct: 121 AFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI 180