NC_002695 | |
Chromosome | NC_002695 |
Query | gi|15829852 |
Alignment | >1bl0A 6 107 149 249 7e-08 ref|NP_415098.1| envelope protein; thermoregulation of porin biosynthesis [Escherichia coli K12] gb|AAC73667.1| envelope protein; thermoregulation of porin biosynthesis; transcriptional activator of envelope proteins, thermoregulation of porin biosynthesis (AraC/XylS familiy) [Escherichia coli K12] dbj|BAA35200.1| EnvY protein [Escherichia coli K12] gb|AAB40763.1| porin thermoregulatory protein [Escherichia coli] pir||D64789 transcription regulator envY - Escherichia coli (strain K-12) sp|P10805|ENVY_ECOLI Porin thermoregulatory protein envY Length = 101 Score = 127 bits (468), Expect = 6e-29 Identities = 86/101 (85%), Positives = 86/101 (85%) Query: 149 DSVCRIIQSDIQHYWNLRIVAXXXXXXXXXXXXXXXNENTSYSQIVTECRMRYAVQMLLM 208 DSVCRIIQSDIQHYWNLRIVA NENTSYSQIVTECRMRYAVQMLLM Sbjct: 1 DSVCRIIQSDIQHYWNLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLM 60 Query: 209 DNKNITQVAQLCGYSSTSYFISVFKAFYGLTPLNYLAKQRQ 249 DNKNITQVAQLCGYSSTSYFISVFKAFYGLTPLNYLAKQRQ Sbjct: 61 DNKNITQVAQLCGYSSTSYFISVFKAFYGLTPLNYLAKQRQ 101 |