NC_002695 | |
Chromosome | NC_002695 |
Query | gi|15833440 |
Alignment | >1fjgJ 1 96 5 100 1e-32 ref|NP_709109.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 301] gb|AAN44816.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 301] ref|NP_839549.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 2457T] ref|NP_755956.1| 30S ribosomal protein S10 [Escherichia coli CFT073] gb|AAP19360.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 2457T] emb|CAA23633.1| ribosomal protein S10 [Escherichia coli] emb|CAA26459.1| unnamed protein product [Escherichia coli] gb|AAN82530.1| 30S ribosomal protein S10 [Escherichia coli CFT073] ref|NP_417780.1| 30S ribosomal subunit protein S10 [Escherichia coli K12] gb|AAC76346.1| 30S ribosomal subunit protein S10 [Escherichia coli K12] emb|CAC44765.1| N utilisation substance protein E-S10 [Expression vector pNCO113-nusB/nusE] gb|AAA58118.1| 30S ribosomal subunit protein S10 [Escherichia coli] pir||R3EC10 ribosomal protein S10 [validated] - Escherichia coli (strain K-12) gb|AAG58442.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 EDL933] dbj|BAB37609.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7] pir||B91152 30S ribosomal subunit protein S10 [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||F85997 30S ribosomal subunit protein S10 [imported] - Escherichia coli (strain O157:H7, substrain EDL933) ref|NP_312213.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7] pdb|1P87|J Chain J, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome pdb|1P6G|J Chain J, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome sp|P02364|RS10_ECOLI 30S ribosomal protein S10 ref|NP_289882.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 EDL933] prf||2111328B NusE protein Length = 96 Score = 128 bits (473), Expect = 2e-29 Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 5 RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 64 RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ Sbjct: 1 RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60 Query: 65 YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI 100 YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI Sbjct: 61 YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI 96 |