NC_002754 | |
Chromosome | NC_002754 |
Query | gi|15897850 |
Alignment | >1qb2B 1 107 334 437 2e-17 pdb|1QZX|B Chain B, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication pdb|1QZX|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication pdb|1QZW|G Chain G, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication pdb|1QZW|E Chain E, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication pdb|1QZW|C Chain C, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication pdb|1QZW|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication Length = 104 Score = 150 bits (556), Expect = 2e-35 Identities = 93/104 (89%), Positives = 93/104 (89%) Query: 326 KLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMT 385 KLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMT Sbjct: 1 KLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMT 60 Query: 386 YKELENPNIIDKSRMRRIAEGSGXXXXXXXXXXXWYNNMNRLLK 429 YKELENPNIIDKSRMRRIAEGSG WYNNMNRLLK Sbjct: 61 YKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLK 104 |