NC_005835 | |
Chromosome | NC_005835 |
Query | gi|46198981 |
Alignment | >1fjgP 1 83 1 83 1e-25 ref|YP_004648.1| SSU ribosomal protein S16P [Thermus thermophilus HB27] ref|YP_144301.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] gb|AAS81021.1| SSU ribosomal protein S16P [Thermus thermophilus HB27] dbj|BAD70858.1| 30S ribosomal protein S16 [Thermus thermophilus HB8] sp|P80379|RS16_THETH 30S ribosomal protein S16 sp|P62238|RS16_THET2 30S ribosomal protein S16 pdb|1N36|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position pdb|1N34|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position pdb|1N33|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin pdb|1N32|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin pdb|1XNR|P Chain P, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center pdb|1XNQ|P Chain P, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center pdb|1XMQ|P Chain P, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center pdb|1XMO|P Chain P, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center pdb|1HR0|P Chain P, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1J5E|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit pdb|1I97|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline pdb|1I96|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) pdb|1I95|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine pdb|1I94|P Chain P, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 pdb|1IBM|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBL|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1IBK|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1HNZ|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1HNX|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1HNW|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus pdb|1FJG|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 83 Score = 117 bits (428), Expect = 6e-26 Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL 60 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL Sbjct: 1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWL 60 Query: 61 SVGAQPTDTARRLLRQAGVFRQE 83 SVGAQPTDTARRLLRQAGVFRQE Sbjct: 61 SVGAQPTDTARRLLRQAGVFRQE 83 |